DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and CG13375

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster

Alignment Length:186 Identity:68/187 (36%)
Similarity:107/187 (57%) Gaps:11/187 (6%)


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            :||||:||..|||:::..||:...|..||..|||:.::....:.|....|:||||||:.:|.|||
  Fly    48 HKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMR 112

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDL----EEERVVGKE 129
            .|.:.:...|:|||.:|..:||.:::.:|:||...|.|..||:|:||||.||    |.||.|...
  Fly   113 ALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDLLADGETEREVEYA 177

  Fly   130 LGKNLAT-QFNCAFMETSAKAKVNVNDIFYDLVRQIN---KKSP---EKKQKKPKK 178
            ..:::.| .:...|:|.||.:..|:..:|.:|:.|..   ..||   .::|..|::
  Fly   178 TTESVVTVDWENGFVEASASSNENITQVFKELLAQAKITYNLSPALRRRRQSLPQQ 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 64/166 (39%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 64/167 (38%)
Ras_dva 49..239 CDD:206714 68/186 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121209
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24070
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.