DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and Mras

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_037113.2 Gene:Mras RGDID:3111 Length:208 Species:Rattus norvegicus

Alignment Length:195 Identity:98/196 (50%)
Similarity:134/196 (68%) Gaps:14/196 (7%)


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            ||:||:|.|||||||||:||.|.|||..|||||||||.|..|:|.|..:|::|||||.|:|:|||
  Rat    14 YKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMR 78

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            :.||:.|.||::|||:|.:::|..:....:.||||||.:..||:||.||.||...|.:.::.||.
  Rat    79 EQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITRDQGKE 143

  Fly   134 LATQFNCAFMETSAK-AKVNVNDIFYDLVRQINKKSPEKKQKKPKKS-------------LCVLL 184
            :||::|..::||||| ..:||:..|:||||.|.::.|||.|||.||:             .||:|
  Rat   144 MATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL 208

  Fly   185  184
              Rat   209  208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 87/162 (54%)
MrasNP_037113.2 M_R_Ras_like 12..176 CDD:133345 87/162 (54%)
small_GTPase 26..178 CDD:197466 78/152 (51%)
Effector region 42..50 8/8 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.