DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and ras1

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_593579.1 Gene:ras1 PomBaseID:SPAC17H9.09c Length:219 Species:Schizosaccharomyces pombe

Alignment Length:173 Identity:99/174 (57%)
Similarity:137/174 (79%) Gaps:2/174 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            :||||:||:|.|||||||||:|.:|..||::|||||||||||:.|:||:..:|::|||||.|:::
pombe     6 LREYKLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEEYS 70

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||:.||:.|:||:|||:||::|:|:::....:|||||||.|..|:|||.||||||.||||.:..
pombe    71 AMREQYMRTGEGFLLVYNITSRSSFDEISTFYQQILRVKDKDTFPVVLVANKCDLEAERVVSRAE 135

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINK--KSPEK 171
            |:.||...:|.::|||||.::||.:.||.|||.|.:  ||.||
pombe   136 GEQLAKSMHCLYVETSAKLRLNVEEAFYSLVRTIRRYNKSEEK 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 94/162 (58%)
ras1NP_593579.1 small_GTPase 7..172 CDD:197466 95/165 (58%)
H_N_K_Ras_like 8..170 CDD:133338 94/162 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 1 1.000 T1124415
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.