DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and let-60

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_502213.3 Gene:let-60 WormBaseID:WBGene00002335 Length:184 Species:Caenorhabditis elegans

Alignment Length:185 Identity:98/186 (53%)
Similarity:134/186 (72%) Gaps:2/186 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |.|||:||:|.|||||||||:|.:|..|||:|||||||||||||.:||:.|:|:||||||.|:::
 Worm     1 MTEYKLVVVGDGGVGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            ||||.||:.|:||:||:::....:|.::.:.||||.||||:||||||||||||||....|..:.:
 Worm    66 AMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDLSSRSVDFRTV 130

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKP-KKSLCVLL 184
            .:. |..:....::||||.::.|::.||.|||:|.|........|| ||..|.::
 Worm   131 SET-AKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKKCQIM 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 91/162 (56%)
let-60NP_502213.3 H_N_K_Ras_like 3..164 CDD:133338 91/162 (56%)
small_GTPase 16..166 CDD:197466 82/151 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.