DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and rap-1

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_501549.1 Gene:rap-1 WormBaseID:WBGene00004307 Length:188 Species:Caenorhabditis elegans

Alignment Length:183 Identity:153/184 (83%)
Similarity:169/184 (92%) Gaps:2/184 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||||||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||
 Worm     1 MREYKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            ||||||||||||||||||||||||||||.|||:|||||||||:|||:|||||||||:||||||:.
 Worm    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQILRVKDTDEVPMILVGNKCDLEDERVVGKDQ 130

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPE--KKQKKPKKSLC 181
            |:|||.||..||:|||||||:||:::|||||||||::.||  ::|.:..|..|
 Worm   131 GQNLARQFGSAFLETSAKAKINVSEVFYDLVRQINRRYPESGRRQGQSNKQCC 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 145/162 (90%)
rap-1NP_501549.1 Rap1 3..166 CDD:133375 146/163 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140256090
eggNOG 1 0.900 E33208_3BE8V
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 307 1.000 Inparanoid score I1559
Isobase 1 0.950 0 Normalized mean entropy S256
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1353024at2759
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 1 1.000 T476641
orthoMCL 1 0.900 OOG5_129336
Panther 1 1.100 LDO PTHR24070
Phylome 1 0.910 0.882 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.