| Sequence 1: | NP_001189023.1 | Gene: | Rap1 / 38244 | FlyBaseID: | FBgn0004636 | Length: | 184 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001254866.1 | Gene: | ral-1 / 175433 | WormBaseID: | WBGene00021811 | Length: | 254 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 196 | Identity: | 89/196 - (45%) | 
|---|---|---|---|
| Similarity: | 137/196 - (69%) | Gaps: | 15/196 - (7%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68 
  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTD-DVPMVLVGNKCDLEEERVVGKELGK 132 
  Fly   133 NLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKK--------------SPEKKQKKPKKSLCVL 183 
  Fly   184 L 184 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Rap1 | NP_001189023.1 | Rap1 | 3..165 | CDD:133375 | 84/161 (52%) | 
| ral-1 | NP_001254866.1 | RAS | 59..223 | CDD:214541 | 84/163 (52%) | 
| RalA_RalB | 59..222 | CDD:206710 | 84/162 (52%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||