Sequence 1: | NP_001189023.1 | Gene: | Rap1 / 38244 | FlyBaseID: | FBgn0004636 | Length: | 184 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254866.1 | Gene: | ral-1 / 175433 | WormBaseID: | WBGene00021811 | Length: | 254 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 89/196 - (45%) |
---|---|---|---|
Similarity: | 137/196 - (69%) | Gaps: | 15/196 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
Fly 69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTD-DVPMVLVGNKCDLEEERVVGKELGK 132
Fly 133 NLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKK--------------SPEKKQKKPKKSLCVL 183
Fly 184 L 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rap1 | NP_001189023.1 | Rap1 | 3..165 | CDD:133375 | 84/161 (52%) |
ral-1 | NP_001254866.1 | RAS | 59..223 | CDD:214541 | 84/163 (52%) |
RalA_RalB | 59..222 | CDD:206710 | 84/162 (52%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |