DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and Rheb

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_730950.2 Gene:Rheb FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster

Alignment Length:173 Identity:72/174 (41%)
Similarity:111/174 (64%) Gaps:0/174 (0%)


  Fly     2 REYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTA 66
            :|..|.::|...||||:|.:|||:..||:.||||||:::.|...|..|..:::::||||.::::.
  Fly     4 KERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSI 68

  Fly    67 MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELG 131
            ....|..:..|:|||||||:|.:|..::.:.|::|.|.....||:||||||.||.:||.|..|.|
  Fly    69 FPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEG 133

  Fly   132 KNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQK 174
            |.||..:..||:|||||...:|.|||:.|:..|..::...::|
  Fly   134 KKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEK 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 71/162 (44%)
RhebNP_730950.2 small_GTPase 4..167 CDD:197466 71/163 (44%)
RheB 5..182 CDD:206709 72/173 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121334
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24070
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.