DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and Rap1a

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_663516.1 Gene:Rap1a MGIID:97852 Length:184 Species:Mus musculus

Alignment Length:185 Identity:160/186 (86%)
Similarity:175/186 (94%) Gaps:2/186 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:|||||||||||||||||||.|||||||||||||||||||||.|||||||||||||||||
Mouse     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||||||||||||.|||||||||||||||||||||||||||:||||:|||||||||:|||||||.
Mouse    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQ 130

  Fly   131 GKNLATQF-NCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184
            |:|||.|: ||||:|:|||:|:|||:||||||||||:|:|.:| |||||..|:||
Mouse   131 GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEK-KKPKKKSCLLL 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 146/163 (90%)
Rap1aNP_663516.1 Rap1 3..167 CDD:133375 147/164 (90%)
Effector region. {ECO:0000305} 32..40 8/8 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BE8V
Hieranoid 1 1.000
Homologene 1 1.000 H2162
Inparanoid 1 1.050 316 1.000 Inparanoid score I2520
Isobase 1 0.950 0 Normalized mean entropy S256
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 1 1.000 T615578
orthoMCL 1 0.900 OOG5_129336
Panther 1 1.100 LDO PTHR24070
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.