DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and LOC100485959

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_004920180.1 Gene:LOC100485959 ID: Length:226 Species:Xenopus tropicalis

Alignment Length:182 Identity:101/183 (55%)
Similarity:134/183 (73%) Gaps:1/183 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |.|||:||:|:|||||||||:|.:|..||::|||||||||||||.:||:.|:|:||||||.|:::
 Frog     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            ||||.||:.|:||:.|::|....:|.|:...||||.||||::||||||||||||| ..|.|..:.
 Frog    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL-PSRTVDTKQ 129

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCV 182
            .::||..:...|:|||||.:..|.|.||.|||:|.:...:|..|:.|...||
 Frog   130 AQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKMSKEEKTPGCV 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 95/162 (59%)
LOC100485959XP_004920180.1 H_N_K_Ras_like 3..164 CDD:133338 95/162 (59%)
RAS 16..166 CDD:214541 85/151 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.