DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and LOC100332969

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_003199211.1 Gene:LOC100332969 ID: Length:183 Species:Danio rerio

Alignment Length:182 Identity:109/183 (60%)
Similarity:141/183 (77%) Gaps:3/183 (2%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:||||||||||||||||||...|:|||||||||.|||::|||....:||||||||||||.
Zfish     1 MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            :|||||:||||||:||||:..|.:|.|::.:|:||:|||..:.||::|||||.|||.||.|..:.
Zfish    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSVQE 130

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQIN-KKSPEKKQKKPKKSLC 181
            |:.||.::.|.|:|||||:|..|:::|.::|||:: ...|:|..  |..|.|
Zfish   131 GQALAEEWGCPFIETSAKSKTMVDELFAEIVRQMDYAAQPDKDD--PCCSSC 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 102/162 (63%)
LOC100332969XP_003199211.1 Rap2 3..165 CDD:133376 102/162 (63%)
RAS 16..164 CDD:214541 90/148 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1353024at2759
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.