DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and mras

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_003201047.1 Gene:mras ZFINID:ZDB-GENE-050208-495 Length:209 Species:Danio rerio

Alignment Length:195 Identity:94/196 (48%)
Similarity:131/196 (67%) Gaps:14/196 (7%)


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            ||:||:|.|||||||||:||.|.|||..|||||||||.|..|:|||..:|::|||||.|:|:|||
Zfish    15 YKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQWAILDVLDTAGQEEFSAMR 79

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            :.||:.|.||::|:|:|.:::|..:....:.||||||.:..|||||.||.||...|.:..|.|:.
Zfish    80 EQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKITSEQGRE 144

  Fly   134 LATQFNCAFMETSAK-AKVNVNDIFYDLVRQINKKSPEKKQKKPKKSL-------------CVLL 184
            :|::.:..::||||| ..:||:..|::|||.|.::.||:..||.:|..             ||||
Zfish   145 MASKHSITYIETSAKDPPMNVDKAFHELVRVIRQQIPERGLKKKRKGKWRADRPSASQRLHCVLL 209

  Fly   185  184
            Zfish   210  209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 85/162 (52%)
mrasXP_003201047.1 P-loop_NTPase 13..177 CDD:304359 85/162 (52%)
small_GTPase 27..179 CDD:197466 76/152 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.