DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and rap1a

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001096357.1 Gene:rap1a XenbaseID:XB-GENE-5801166 Length:185 Species:Xenopus tropicalis

Alignment Length:185 Identity:158/186 (85%)
Similarity:175/186 (94%) Gaps:1/186 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:|||||||||||||||||||.||||||||||||||||||||:||||||||||||||||||
 Frog     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVEGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||||||||||||.|||||||||||||||||||||||||||:||||:|||||||||:|||||||.
 Frog    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQ 130

  Fly   131 GKNLATQF-NCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184
            |:|||.|: ||||:|:|||:|:|||:||||||||||:|:|.:|:|..||..|:||
 Frog   131 GQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPGKKPKCLLL 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 146/163 (90%)
rap1aNP_001096357.1 Rap1 3..167 CDD:133375 147/164 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BE8V
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2162
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1353024at2759
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.790

Return to query results.
Submit another query.