DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr92F

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:226 Identity:69/226 - (30%)
Similarity:93/226 - (41%) Gaps:63/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVILSLALFASVAVARPGYALDYYDH---PKYAFNYGVADHSTGDVKSQHETRDGD-VVKGQYSL 67
            |.|.:..|.::|:.:..|.....|.|   ..:.::||.||.::    .:||||..| ...|.||.
  Fly     4 FFIAAALLISTVSASWHGAVSTQYQHLDPHSHTYSYGYADPNS----QKHETRSHDGTTHGSYSY 64

  Fly    68 VEPDGSIRTVDYTADSIHGFNAVVTK--SGPTVHAQAVVAS-------------PIVAHKPVLTH 117
            |:..|.:::|.||||..||||||.|.  ..|.|||..|.|:             ||  |.|||||
  Fly    65 VDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGAYAPYAHGPI--HIPVLTH 127

  Fly   118 ----YEPQVVKHVAPVAHAPLVVASPAPYVAKHYAPAAAAPIHYDYDDGYYNQGQQY---EYIP- 174
                .:...|:| |..|||           |.|.|.|..|..|:.|....|..|..|   .::| 
  Fly   128 GGVPVDTPEVQH-AKAAHA-----------AAHAAAAHNAGGHHLYKRSIYGGGWAYGQAAHVPL 180

  Fly   175 ---------------QYDQYSGH---YGHYA 187
                           :.:.|:.|   .||.|
  Fly   181 THGGVPVDTPDVQAAKAEHYAAHAKALGHVA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 20/52 (38%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.