DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Ccp84Ac

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster

Alignment Length:172 Identity:73/172 - (42%)
Similarity:91/172 - (52%) Gaps:32/172 - (18%)


  Fly    32 HPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGP 96
            ||||.|.|.|.|..:||.|||.|:||||||:|:|||.:.||..|||.|||||::||||||.:. |
  Fly    62 HPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHRE-P 125

  Fly    97 TVHAQAVVASPIVAHKPVLTHYEPQVVKHVAPVAHAPLV--VASPA-PYVAKHY-APAAAAPIHY 157
            ..|    |...:||..||..|:        ||.|.|.::  .|||: .|||..| |||..||.:.
  Fly   126 LAH----VHHKVVAAAPVQYHH--------APAAAAAVIKSYASPSQAYVAPTYAAPAYTAPAYA 178

  Fly   158 DYDDGYYNQGQQYEYIPQYDQYSGHYGHYASP------YAGH 193
            .:         |.|...:.:....||..|.||      :.||
  Fly   179 TH---------QAEQPQEREHQQHHYASYESPAHAQAAHEGH 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 31/51 (61%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.