DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr72Ec

DIOPT Version :8

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster

Alignment Length:89 Identity:29/89 - (32%)
Similarity:47/89 - (52%) Gaps:8/89 - (8%)


  Fly     6 CF--VILS--LALFASVAV-ARPGYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQY 65
            ||  .||.  |||.::..: .||.......|..:..::||..|.:.  .::::.:||| ..:|.|
  Fly     3 CFTWTILGGLLALTSAAGLPQRPSSGYQEQDTARAFYSYGYRDENA--ARAEYSSRDG-TSRGFY 64

  Fly    66 SLVEPDGSIRTVDYTADSIHGFNA 89
            |.|:.||.::||.|.|:.:.||.|
  Fly    65 SYVDADGKLQTVRYEANGVQGFKA 88

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:278791 16/51 (31%)
Rib_recp_KP_reg <70..>141 CDD:282899 9/20 (45%)
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.