DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr72Ea

DIOPT Version :8

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster

Alignment Length:283 Identity:63/283 - (22%)
Similarity:95/283 - (33%) Gaps:113/283 - (39%)


  Fly    12 LALFASVAVARPGYALDYYDHPKYA---------------------FNYGVADHSTGDVKSQHET 55
            |.|..|:::|. |.|| ||.:...|                     ::||.::    .:.|:.||
  Fly     5 LLLLGSLSLAH-GLAL-YYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSE----PLSSKQET 63

  Fly    56 R--DGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTK------------------SGPTVH- 99
            |  || :.:|.||..:..|.::||:|.||: .||:...|.                  |.|..| 
  Fly    64 RTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVPQESLEFSPRSASHPVDHH 126

  Fly   100 -------AQAVVASPIVAHKPV----------------------LTHYEPQVVKHVAPVAHAPLV 135
                   :.|||..| |.|.|:                      :.|:|.:|.....||.|.|:.
  Fly   127 VEHHAEVSHAVVQHP-VGHHPIEVPHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHPVE 190

  Fly   136 V------------ASPAPY--VAKHYAPAAAA-------PIHYDYDDGYYNQG-----------Q 168
            |            |.|..:  |..|..|.|.|       |:...:.......|           :
  Fly   191 VPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHSIE 255

  Fly   169 QYEY-IPQYDQYSGHYGHYASPY 190
            .:|: :...|....|.||...|:
  Fly   256 HHEHPVSGSDPSGSHGGHSQLPH 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:278791 18/74 (24%)
Rib_recp_KP_reg <70..>141 CDD:282899 29/130 (22%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.