| Sequence 1: | NP_001137869.1 | Gene: | Cpr62Bb / 38240 | FlyBaseID: | FBgn0035280 | Length: | 194 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261293.1 | Gene: | Cpr62Bc / 38241 | FlyBaseID: | FBgn0035281 | Length: | 180 | Species: | Drosophila melanogaster |
| Alignment Length: | 209 | Identity: | 89/209 - (42%) |
|---|---|---|---|
| Similarity: | 108/209 - (51%) | Gaps: | 51/209 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 NFVCFVILSLA-----------LFASVAVARPGY-----ALDYYDHPKYAFNYGVADHSTGDVKS 51
Fly 52 QHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLT 116
Fly 117 HYEPQVVKHVAP-VAHAPLVVASPAPYVAKHYAPAAAAPIHYDYDDGYYNQGQQYEYIPQYDQYS 180
Fly 181 GHYGHYASPYAGHY 194 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpr62Bb | NP_001137869.1 | Chitin_bind_4 | 35..87 | CDD:395303 | 40/51 (78%) |
| Cpr62Bc | NP_001261293.1 | Chitin_bind_4 | 54..106 | CDD:395303 | 40/51 (78%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2C9WU | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D130248at33392 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR12236 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.920 | |||||