DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr62Bc

DIOPT Version :8

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster

Alignment Length:209 Identity:89/209 - (42%)
Similarity:108/209 - (51%) Gaps:51/209 - (24%)


  Fly     3 NFVCFVILSLA-----------LFASVAVARPGY-----ALDYYDHPKYAFNYGVADHSTGDVKS 51
            :.:|..:||.|           |:|:......|:     .:||:.:|||.:||||||..||||||
  Fly     6 SLICLAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKS 70

  Fly    52 QHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLT 116
            |||.||||||||.|||||||||:|||:||||..:||||||.|:|||||                 
  Fly    71 QHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVH----------------- 118

  Fly   117 HYEPQVVKHVAP-VAHAPLVVASPAPYVAKHYAPAAAAPIHYDYDDGYYNQGQQYEYIPQYDQYS 180
            |..|.||.|.|| |.||   ..:.||.:|.|.|.|.|.|.          .|.....:|.|    
  Fly   119 HAAPAVVAHAAPAVVHA---APAYAPAIAHHVAAAPAVPY----------AGSLAHQVPAY---- 166

  Fly   181 GHYGHYASPYAGHY 194
            |:..|.|..:..||
  Fly   167 GYATHNAHAHVAHY 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:278791 40/51 (78%)
Rib_recp_KP_reg <70..>141 CDD:282899 33/71 (46%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:278791 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.