DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr56F

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:76 Identity:26/76 - (34%)
Similarity:41/76 - (53%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVT 92
            :.|...||.|.|.|.|:.:|:.....|:||||:..|:|.::.|||..:.|:|.||. :|:.    
  Fly   121 EQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ-NGYR---- 180

  Fly    93 KSGPTVHAQAV 103
               ||:..:.|
  Fly   181 ---PTIRYEQV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 20/51 (39%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.