powered by:
Protein Alignment Cpr62Bb and Crys
DIOPT Version :9
| Sequence 1: | NP_001137869.1 |
Gene: | Cpr62Bb / 38240 |
FlyBaseID: | FBgn0035280 |
Length: | 194 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001285854.1 |
Gene: | Crys / 34604 |
FlyBaseID: | FBgn0005664 |
Length: | 477 |
Species: | Drosophila melanogaster |
| Alignment Length: | 66 |
Identity: | 41/66 - (62%) |
| Similarity: | 50/66 - (75%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 DYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVT 92
||...|:|:|.|.|.|..|||.|.|.|.||||:|||||||:||||:.|.|:||||.:.||||:|:
Fly 70 DYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVS 134
Fly 93 K 93
|
Fly 135 K 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.