DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr5C

DIOPT Version :8

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster

Alignment Length:146 Identity:61/146 - (41%)
Similarity:77/146 - (52%) Gaps:41/146 - (28%)


  Fly    12 LALFASVA-------VARPGYAL---DYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYS 66
            :|.:|:.|       ||:|..|.   :|..||:|.:.|.|.|..:||.|||.|.||||||:|:||
  Fly    31 VATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYS 95

  Fly    67 LVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLTHYEPQVVKHVAPVAH 131
            ||:.||..|||.||||.|:||||||.:            .|:|          ..|||.||||  
  Fly    96 LVDSDGFKRTVQYTADPINGFNAVVNR------------EPLV----------KTVVKTVAPV-- 136

  Fly   132 APLVVASPAPYVAKHY 147
            ||:       |.|.|:
  Fly   137 APV-------YAAYHH 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:278791 31/51 (61%)
Rib_recp_KP_reg <70..>141 CDD:282899 27/70 (39%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.