DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12020 and CG5001

Sequence 1:NP_647662.1 Gene:CG12020 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:382 Identity:111/383 (29%)
Similarity:177/383 (46%) Gaps:80/383 (21%)


  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDK--KDEQDFVPLAQEGRLTHLSPMGEPRQWAY 69
            |||.:|..|:.||.::|..|||:||:|..|.::|  ..|..|..:|:                  
  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAE------------------ 50

  Fly    70 VNMAFDVLGNDLYRAIYDRFGEAGLFEGVML---PNGYFPPYQYDGDHMKVYERVFGSYSPYANV 131
               |::||.:...|.:||::||.||..|...   |:.....||:.||....:.:.||:.:|:|:.
  Fly    51 ---AYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASF 112

  Fly   132 IDA-----------ISNPPSLYATRQHGIGVR--------------------------SKDASTE 159
            .|.           :...|..:::...|||.|                          .:|...|
  Fly   113 FDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVE 177

  Fly   160 RIIELSLEEVRTGCVKLMNVWRQEIVDAKESRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPA 224
            ..:.::|||:..||||.|.:.|: ||.|..|..::.|. |.::|.||..:||:..|::|||:.|.
  Fly   178 HDLYVTLEEIYHGCVKKMKISRR-IVQADGSSRKEEKF-LAISIKPGWKSGTKVTFQKEGDQAPG 240

  Fly   225 TIPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRRQLKV-VITDVVQPG 288
            .||.||:||..||||..|:|... ||.|...:.|.||..|..|.:.|:...:|:: .:.::::|.
  Fly   241 KIPADIVFIIRDKPHAMFKREGS-DLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPN 304

  Fly   289 YTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHMKHITRE 345
            ..|.:...|||         ..|:..:|    |||::.||..||:.||...|.:.::
  Fly   305 TVKRIQGYGLP---------FPKDTTRK----GDLLVAFDIQFPEKLTAAQKEVLKD 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 111/383 (29%)
DnaJ 7..87 CDD:278647 24/82 (29%)
DnaJ_C 156..335 CDD:199909 62/180 (34%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 111/380 (29%)
DnaJ 4..65 CDD:278647 24/82 (29%)
DnaJ_C 174..338 CDD:199909 62/180 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116653405
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24078
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.