DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and kdrl

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_571547.1 Gene:kdrl ZFINID:ZDB-GENE-000705-1 Length:1301 Species:Danio rerio

Alignment Length:288 Identity:51/289 (18%)
Similarity:87/289 (30%) Gaps:100/289 (35%)


  Fly   759 ANFQCHAAHGCVCRSGYTGDNCDELIASQRIADQSENSSRASVALTLVLMTLFACIIFAVFIYYR 823
            |.|..|....|:......|....:   .|.:.|...:.......|||:.....|       :::|
Zfish    10 AFFTLHVLFSCISHGLVEGSRLPD---PQLLPDGDTHLQHVGETLTLICRGSTA-------LHWR 64

  Fly   824 ---RRVSNLKTEIAHVHYTHDTNPPSWPPNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMS 885
               |.||:::.|                            ..|.||..:..:..::|.....|  
Zfish    65 LASRNVSSVRIE----------------------------SCEERLHKHCSKLVIHNLRHNDT-- 99

  Fly   886 TDYGDDCNASGRVGSYSINY----NHDLLTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDP 946
                         |.||.::    :|::.|.....|..:|.|                 |.|..|
Zfish   100 -------------GIYSCSHKKSSDHEVSTYVFVKDPHHPFV-----------------EAYSLP 134

  Fly   947 VKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEK------PSNVKNMTVLLNK 1005
            ..:::   :..|.|    :..|..:..|:.:.:.:..:|...|:.|      |.  |..||    
Zfish   135 HPLFA---YRNDPY----FVVPCRTTYPNQNVILETQMNPMADDVKRGVQWDPK--KGFTV---- 186

  Fly  1006 PLPPTEPEPQHECFDNTNTNLDNVSTAS 1033
            ||.|.:......|.    |.:||...:|
Zfish   187 PLKPYDSYHLITCL----TRVDNAEFSS 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
kdrlNP_571547.1 IG_like 47..120 CDD:214653 19/123 (15%)
IG_like 228..319 CDD:214653
Ig 236..321 CDD:299845
IG_like 338..415 CDD:214653
Ig 343..415 CDD:299845
Ig 441..533 CDD:143165
IG_like 553..631 CDD:214653
I-set 646..728 CDD:254352
Ig 659..725 CDD:143165
PKc_like 800..1141 CDD:304357
Pkinase_Tyr 808..1134 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.