DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and Pear1

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001027585.1 Gene:Pear1 MGIID:1920432 Length:1034 Species:Mus musculus

Alignment Length:1118 Identity:366/1119 (33%)
Similarity:493/1119 (44%) Gaps:172/1119 (15%)


  Fly     1 MLPVILIACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWC---VTFPPRC 62
            :.|::|:|    |.|......:.:.||:|...|.:......:.|:.|....:..|   ...|..|
Mouse     3 LCPLLLLA----LGLRLTGTLNSNDPNVCTFWESFTTTTKESHLRPFSLLPAESCHRPWEDPHTC 63

  Fly    63 STYRIKHRVVNKTKTIAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPA 127
            :...:.:|.|.:......:|....||.||..|.|.|||.|::.|.||||::|.:|:|..|:.|..
Mouse    64 AQPTVVYRTVYRQVVKMDSRPRLQCCRGYYESRGACVPLCAQECVHGRCVAPNQCQCAPGWRGGD 128

  Fly   128 CDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCEN 192
            |...|.||.:|..|...|.|.||:.|:|.||.|.|..|.....|...||.|.:|..|...|:| .
Mouse   129 CSSECAPGMWGPQCDKFCHCGNNSSCDPKSGTCFCPSGLQPPNCLQPCPAGHYGPACQFDCQC-Y 192

  Fly   193 GGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVC 257
            |..|....|.|.|.||..||.|::.|..|..|..|.:..||||.|..|...|:|.|.|||.|.:|
Mouse   193 GASCDPQDGACFCPPGRAGPSCNVPCSQGTDGFFCPRTYPCQNGGVPQGSQGSCSCPPGWMGVIC 257

  Fly   258 ANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCAND 322
            :..||.|.:||.|.:.|.|:.|..|...||||.|.|||.|:||.:||.:..:|.:|:.|||||..
Mouse   258 SLPCPEGFHGPNCTQECRCHNGGLCDRFTGQCHCAPGYIGDRCQEECPVGRFGQDCAETCDCAPG 322

  Fly   323 AMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSA 387
            |.|..|||.|:|..|:||.:|.||:|...:|||.|...|.||.||:..|||..|.|.|..||:..
Mouse   323 ARCFPANGACLCEHGFTGDRCTERLCPDGRYGLSCQEPCTCDPEHSLSCHPMHGECSCQPGWAGL 387

  Fly   388 QCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQ 452
            .|...|....:||.|:..|.|.:|..|...:|.|.||||:.||.|...|.|.|:|.:|:.||.|:
Mouse   388 HCNESCPQDTHGPGCQEHCLCLHGGLCLADSGLCRCAPGYTGPHCANLCPPDTYGINCSSRCSCE 452

  Fly   453 NGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGER 517
            |...|.|..|.|:|..||:...|..||.|..:|.:|...|.|.::..|:||.|:|||..||.|..
Mouse   453 NAIACSPIDGTCICKEGWQRGNCSVPCPLGTWGFNCNASCQCAHDGVCSPQTGACTCTPGWHGAH 517

  Fly   518 CERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRC 582
            |:..|..|:||..||..|.||  :|..||..:|:|.|:..|.|..|...|..|::|.||...|.|
Mouse   518 CQLPCPKGQFGEGCASVCDCD--HSDGCDPVHGQCRCQAGWMGTRCHLPCPEGFWGANCSNTCTC 580

  Fly   583 LNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYI 647
            .|..:|..::|||:|:.|:.|..|..|||||.||..|                    :.|     
Mouse   581 KNGGTCVSENGNCVCAPGFRGPSCQRPCPPGRYGKRC--------------------VQC----- 620

  Fly   648 GLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCR 712
                               |||..| ..|:...|.|.||.||||.:|:|:||...:|..|:|.|:
Mouse   621 -------------------KCNNNH-SSCHPSDGTCSCLAGWTGPDCSEACPPGHWGLKCSQLCQ 665

  Fly   713 CVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHG-CVCRSGYT 776
            |.|...|...||.|||..||:|..|.|.||...:|.:|...|.|.... .||...| |||..|::
Mouse   666 CHHGGTCHPQDGSCICTPGWTGPNCLEGCPPRMFGVNCSQLCQCDLGE-MCHPETGACVCPPGHS 729

  Fly   777 GDNC----DELIASQRIADQSENSSRASVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVH 837
            |.:|    .|.......:..:.||..|.:.:. ||.||...:| |:||.||:.....:.|...|.
Mouse   730 GADCKMGSQESFTIMPTSPVTHNSLGAVIGIA-VLGTLVVALI-ALFIGYRQWQKGKEHEHLAVA 792

  Fly   838 YT------HDTNPPSWPP--NHNFDNPVY-----------------------GMQAETRLLPNNM 871
            |:      .|...|...|  :|.:.||.|                       ..||..|  |:..
Mouse   793 YSTGRLDGSDYVMPDVSPSYSHYYSNPSYHTLSQCSPNPPPPNKVPGSQLFVSSQAPER--PSRA 855

  Fly   872 RSKMNNFDQRSTMSTDY-----GDDCNASGRVGSYSINYNHDLLTKNLNADRTNPIVYNE----- 926
            ..:.|:.    |:..|:     ..:..||....|||.:|:|          |..|..:..     
Mouse   856 HGRENHV----TLPADWKHRREPHERGASHLDRSYSCSYSH----------RNGPGPFCHKGPIS 906

  Fly   927 ---------SLKEEHVYDEIK---------HKEGY---KDPVKIYSKILFPEDEYDHLDYSRPST 970
                     ||..|:.|..|:         .:.||   |.|                     ||.
Mouse   907 EEGLGASVMSLSSENPYATIRDLPSLPGEPRESGYVEMKGP---------------------PSV 950

  Fly   971 S---QKPHYHRMNDAMLNINQDE---EKPSNVKNMTVLLNK--PLPPTEPEPQHECFDNTNT--N 1025
            |   |..|........|...:|.   |:||.:.:....|..  ||||..|...::...|::.  :
Mouse   951 SPPRQSLHLRDRQQRQLQPQRDSGTYEQPSPLSHNEESLGSTPPLPPGLPPGHYDSPKNSHIPGH 1015

  Fly  1026 LDNVSTASPSSSP 1038
            .|......|.|.|
Mouse  1016 YDLPPVRHPPSPP 1028

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 15/68 (22%)
EGF_CA 274..319 CDD:304395 22/45 (49%)
DSL <479..518 CDD:302925 16/39 (41%)
DSL <567..606 CDD:302925 15/39 (38%)
Pear1NP_001027585.1 EMI 25..93 CDD:284877 15/68 (22%)
EGF_CA 535..580 CDD:304395 18/47 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001055
OrthoInspector 1 1.000 T617058
orthoMCL 1 0.900 OOG5_128415
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.770

Return to query results.
Submit another query.