DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and Megf10

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001001979.1 Gene:Megf10 MGIID:2685177 Length:1147 Species:Mus musculus

Alignment Length:1161 Identity:400/1162 (34%)
Similarity:553/1162 (48%) Gaps:154/1162 (13%)


  Fly     6 LIACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWCVTFPP--RCSTYRIK 68
            ||..|....:..|...:|:.||:|...|.|:|.|..:....|.:...|.|.....  :|:.:||.
Mouse    11 LICSLLCHWVGTASSLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCTRHRIS 75

  Fly    69 HRVVNK--TKTIAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDIN 131
            :|...:  .||:.:.:  ..||.|:..|...|||||::.|.|||||:|..|:|:.|:||..|...
Mouse    76 YRTAYRHGEKTMYRRK--SQCCPGFYESRDMCVPHCADKCVHGRCIAPNTCQCEPGWGGTNCSSA 138

  Fly   132 CPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKC 196
            |....:|.:||.:|.|.|.|:|.|.:|.|.||.||.|.||.|.|.:|.:|.:|.::|:|:||..|
Mouse   139 CDGDHWGPHCSSRCQCKNRALCNPITGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQCQNGATC 203

  Fly   197 HHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCANKC 261
            .|::|||:|:||:||..|:..||.||||..|:|.|||||.|.|...||.|.|..||.|.||...|
Mouse   204 DHITGECRCSPGYTGAFCEDLCPPGKHGPHCEQRCPCQNGGVCHHVTGECSCPSGWMGTVCGQPC 268

  Fly   262 PVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCD 326
            |.|.:|..|.:.|:|:.|..|...||||.|.|||.||||.|||.:.:||..|:..|.|.|...|.
Mouse   269 PEGRFGKNCSQECQCHNGGTCDAATGQCHCSPGYTGERCQDECPVGSYGVRCAEACRCVNGGKCY 333

  Fly   327 RANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTR 391
            ..:|||:|..|::|..|..|:|....||:.|::.|.|.:::|..|||.:|.|.|..|||...|..
Mouse   334 HVSGTCLCEAGFSGELCEARLCPEGLYGIKCDKRCPCHLDNTHSCHPMSGECGCKPGWSGLYCNE 398

  Fly   392 PCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAK 456
            .|:...||..|:..|:|:|||.|..|.|.|.||||::|..|...|..|.:|.:|:.||.|:|.|.
Mouse   399 TCSPGFYGEACQQICSCQNGADCDSVTGRCACAPGFKGTDCSTPCPLGRYGINCSSRCGCKNDAV 463

  Fly   457 CEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERK 521
            |.|..|.|:|.|||..:.|...|....:|..|...|.|.|..|||..:|:||||.||.|.:||..
Mouse   464 CSPVDGSCICKAGWHGVDCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGAKCEFP 528

  Fly   522 CDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNS 586
            |..|.:|.:||::|.|  :::..|..|.|.|.|...|.||||::.|..|.:|.||...|.|.|.:
Mouse   529 CQDGTYGLNCAERCDC--SHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGA 591

  Fly   587 SCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTC 651
            ||.||.|.|.|:.|:.|..|...|.|||||..|.:.||:.:|.:..|.||||...|..|:.|..|
Mouse   592 SCSPDDGICECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALC 656

  Fly   652 EHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHH 716
            ...||:|.:|..|...|.|.:.|.||.:...|||.|||.||:|::.||...:|..|...|.|.:.
Mouse   657 NEVCPSGRFGKNCAGVCTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHNG 721

  Fly   717 KVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCD 781
            ..|...||.|.|..||:|..|.:.||.||||:.|...|.|.:.....|.:..|.||:|:.|.:|:
Mouse   722 AFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGFMGRHCE 786

  Fly   782 ELIAS-------QRIADQSENS----------------------------------SRASVAL-- 803
            :...:       ::|.|...||                                  ||.|.||  
Mouse   787 QKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLNSLSRTSTALPA 851

  Fly   804 ------------TLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYT------------HDTNP 844
                        .|||:.||   :.|:||.||.:....::.:..|.||            .:|.|
Mouse   852 DSYQIGAIAGIVVLVLVVLF---LLALFIIYRHKQKRKESSMPAVTYTPAMRVINADYTIAETLP 913

  Fly   845 PSWPPN---HNFDNPVYGMQAETRLLPN-NMRSKMN----------------NFDQRSTMSTDYG 889
            .|...|   |.|.||.|...::....|: |.|.:|.                |..:|.|:.    
Mouse   914 HSNGGNANSHYFTNPSYHTLSQCATSPHVNNRDRMTIAKSKNNQLFVNLKNVNPGKRGTLV---- 974

  Fly   890 DDCN----ASGRVGSY-----SINYNHDLLTKNLNADRTNPIVYNESL----KEEHVYDEIKHKE 941
             ||.    |..:.|.|     :...:...:.|:|. |......||.|.    ..|:.|..|    
Mouse   975 -DCTGTLPADWKQGGYLNELGAFGLDRSYMGKSLK-DLGKNSEYNSSTCSLSSSENPYATI---- 1033

  Fly   942 GYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKP---------SNVK 997
              |||..:..|    ..|..:::...|:....|:....|....|.|..|.:|         ||..
Mouse  1034 --KDPPALLPK----SSECGYVEMKSPARRDSPYAEINNSTPANRNVYEVEPTVSVVQGVFSNSG 1092

  Fly   998 NMTV----------------LLNKPLPPTEPEPQHECFDNTNTNLDNVSTASPSSS 1037
            ::|.                ||  |:..:...|:.|....:|:...|.:::|.|||
Mouse  1093 HVTQDPYDLPKNSHIPCHYDLL--PVRDSSSSPKREDGGGSNSTSSNSTSSSSSSS 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 18/69 (26%)
EGF_CA 274..319 CDD:304395 23/45 (51%)
DSL <479..518 CDD:302925 17/39 (44%)
DSL <567..606 CDD:302925 17/39 (44%)
Megf10NP_001001979.1 Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern. {ECO:0000250|UniProtKB:Q96KG7} 1..857 331/850 (39%)
EMI 32..99 CDD:284877 18/69 (26%)
EGF_CA 281..326 CDD:304395 23/45 (51%)
EGF_CA 542..587 CDD:304395 18/47 (38%)
Necessary for formation of large intracellular vacuoles. {ECO:0000250|UniProtKB:Q96KG7} 945..1147 45/221 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 789 1.000 Inparanoid score I506
Isobase 1 0.950 0 Normalized mean entropy S4145
OMA 1 1.010
OrthoDB 1 1.010 D34806at33208
OrthoFinder 1 1.000 FOG0001055
OrthoInspector 1 1.000 T617058
orthoMCL 1 0.900 OOG5_128415
Panther 1 1.100 LDO PTHR24035
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5768
TreeFam 1 0.960
1211.910

Return to query results.
Submit another query.