DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and tnfaip6

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio

Alignment Length:174 Identity:37/175 (21%)
Similarity:53/175 (30%) Gaps:68/175 (39%)


  Fly   498 AACNPQNGSC---------------TCAAGWTGERCERKCDTGKFGHDCAQK-CQCDF------- 539
            |.||.:.|:.               .|||||        .|.|:.|:...:. ..|.|       
Zfish    66 AVCNFEGGTLATFDQLEAARQIGFHVCAAGW--------LDKGRVGYPIVKAGSNCGFGKVGIID 122

  Fly   540 -----NNSLACDATNGRCVCKQDWGGVHCETN---CRSGYYGENCD-KVC--------------- 580
                 |.|...|......|.| :.||||.:..   ...||..|..| ::|               
Zfish   123 YGYRLNKSERWDVYCYNPVAK-ECGGVHTDPEKVLVSPGYPDEYQDEQICYWHIRVRFGHRIRLH 186

  Fly   581 ----------RCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGF 614
                      .||::.....||.:.:  :|:.|..|.:..|..|
Zfish   187 FLDFDIEEDTDCLSDHLEIYDSYDDV--SGFVGRYCGDQLPDDF 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 9/35 (26%)
DSL <567..606 CDD:302925 11/65 (17%)
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 17/80 (21%)
CUB 145..254 CDD:278839 18/87 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.