DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and pear1

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_700533.4 Gene:pear1 ZFINID:ZDB-GENE-091230-1 Length:1020 Species:Danio rerio

Alignment Length:1081 Identity:351/1082 (32%)
Similarity:502/1082 (46%) Gaps:149/1082 (14%)


  Fly     4 VILIACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWCVTFPPRCSTYRIK 68
            :.::.|:.:|.|: .|.:|   ||:|...|.:...|..:..|.|.:.....|  ..|..:....:
Zfish    10 LFVLGCVCELSLS-LDPRD---PNVCSLWESFTTSVKESYAQPFDQMSEEPC--SEPWSANKCTR 68

  Fly    69 HRVVNKT--KTIAKNRIVR--DCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACD 129
            ||:..||  :.:.|....|  .||.|:..|..:|||.|::.|.||||::|::|:|:.|:.|..|.
Zfish    69 HRITYKTLYRQVVKMDYRRRYQCCPGFYESRNKCVPRCTKECVHGRCVAPDRCQCEMGWRGDDCS 133

  Fly   130 INCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGG 194
            .:|....:|..|...|:|.|...|:..:|:|:|..||||..|.|.||..:||..|.::|:|..||
Zfish   134 SSCDGQHWGPGCRRLCECQNGGECDVLTGNCQCPAGYTGQHCHDPCPVKWFGQGCRQECQCGTGG 198

  Fly   195 KCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCAN 259
            .|:..:|||.|..||||.||:..||..|   :|...|||||.|.|| ..|.|:|.|||.|.||..
Zfish   199 ICNQTTGECVCKQGFTGTLCEESCPRPK---RCAARCPCQNGGICQ-GNGVCLCPPGWMGPVCTE 259

  Fly   260 KCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAM 324
            :||.|.:|..|.:.|.|:.|..|....|||:|..||.||||.:||.:.|||.:|...|||||.|.
Zfish   260 RCPPGRFGINCSKDCLCHNGGHCDQEKGQCQCDAGYTGERCNEECPVGTYGEDCKGVCDCANGAR 324

  Fly   325 CDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQC 389
            |...:|.|:|.||:.|.:|..|:|....:|:.|...|.|:..:|..|||..|.|.|..||:...|
Zfish   325 CYNIHGGCLCEPGFKGPRCDHRMCPEAVFGMHCQHRCLCNPLNTLSCHPLKGECTCQPGWAGLYC 389

  Fly   390 TRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNG 454
            ...|....||..|...|.|.||..|..|.|.|.|.||:.|..||:.||.|.:|:.|...|.|.|.
Zfish   390 NETCAQGYYGNGCLEPCLCVNGGVCDSVTGQCHCPPGFTGLHCEKLCEDGFYGKGCLSACKCVNS 454

  Fly   455 AKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCE 519
            ..|.|..|.|:|..||:...|...|....:|..|.:.|.|.|.|:|:|.:|||.|.|||.|..|:
Zfish   455 IVCSPVDGACICKEGWRGPDCSIACSEGTWGPGCNRTCKCTNGASCDPADGSCKCTAGWRGASCD 519

  Fly   520 RKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLN 584
            ..|..|.||..|..:|.|..:.  .|::..|:|:|...|.||.|...|..|.:|..|::.|.|||
Zfish   520 EPCLIGTFGPGCQNQCDCVHDE--GCESVTGQCLCLPGWTGVRCTQQCPEGTWGIQCNQTCSCLN 582

  Fly   585 NSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGL 649
            :::|...:|.|:|.             |||:|.:                               
Zfish   583 SATCQAHTGTCLCK-------------PGFWGAQ------------------------------- 603

  Fly   650 TCEHPCPAGLYGPGCKLKC-NCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRC 713
             |:|.|.|||:|..|...| .|.|...|:|:||.||||.|:||..|.::||...||..|:..|||
Zfish   604 -CQHMCSAGLFGEKCSRHCPPCVHASSCHHITGDCQCLSGYTGPLCEQACPVGRYGSHCSNVCRC 667

  Fly   714 VHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHG-CVCRSGYTG 777
            .::..|....|:|||..||:|:.|..:|..|.:|.:|..||:|| .|..|...:| |||..| .|
Zfish   668 TNNATCHHEVGLCICPAGWTGSDCSLLCQAGTFGINCAQTCSCP-PNHSCDPHNGDCVCEPG-PG 730

  Fly   778 DNC--DELIASQRIADQSENSSRASVALTLVLMTLFACIIFAVFIYYRRR----------VSNLK 830
            :.|  ::.::........|..|..::| .:|::.:...::.||.:.||||          ||...
Zfish   731 EACKPEQELSVMVPVSPVERDSWGAIA-GIVVLVILVVLLLAVLLLYRRRQQDKQSNTPVVSFSS 794

  Fly   831 TEIAHVHYTHDTNPPSWPPNHNFDNPVYGMQAETR----LLPNNMRSKMNN-----FDQRSTMST 886
            |......|.....|.|:  :|.:.||.|...::.|    .||||....:.|     |.....|..
Zfish   795 TRTVSSEYAVPDVPHSY--HHYYSNPSYHTLSQNRPPLPHLPNNQDRAIKNTNNQLFCSLKNMER 857

  Fly   887 D----YGDDCNAS--------------GRVG-----SYSI----NYNHDLLTKNLNADRTNPIVY 924
            :    :..|.||:              |..|     |||.    :||.:|....:       .|.
Zfish   858 ERRGLFTADTNATLPPGWKHQEPPKDPGAFGIDRSYSYSATLGKHYNKELKDSCV-------AVS 915

  Fly   925 NESLKEEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNI--- 986
            :.||..|:.|..||...|.        .:..||..|..:..:.|  .|:.:...::..::..   
Zfish   916 SSSLNSENPYATIKDLPGL--------PVCPPESSYMEMKSAVP--RQRSYTQIISPPLMTAPAL 970

  Fly   987 ---------NQDEEKPSNVKNMTVLLNKP----LPPTEPEP 1014
                     |.:|::..|..::.:..:.|    |||....|
Zfish   971 PCTGHCSLSNAEEQELQNHYDLPINSHIPGHYDLPPVRRPP 1011

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 17/69 (25%)
EGF_CA 274..319 CDD:304395 22/45 (49%)
DSL <479..518 CDD:302925 17/39 (44%)
DSL <567..606 CDD:302925 12/39 (31%)
pear1XP_700533.4 EMI 29..96 CDD:284877 17/69 (25%)
Laminin_EGF 411..451 CDD:278482 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 815 1.000 Inparanoid score I452
OMA 1 1.010
OrthoDB 1 1.010 D34806at33208
OrthoFinder 1 1.000 FOG0001055
OrthoInspector 1 1.000 T597958
orthoMCL 1 0.900 OOG5_128415
Panther 1 1.100 O PTHR24035
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.