DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and Dkk2

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_006501881.1 Gene:Dkk2 MGIID:1890663 Length:272 Species:Mus musculus

Alignment Length:266 Identity:60/267 (22%)
Similarity:85/267 (32%) Gaps:103/267 (39%)


  Fly   222 KHGAQCQQDCPCQNDGKCQ-------PETG--ACMCNPGWTGDVCANKCPVGSYGPGCQESCECY 277
            ||..|..:..||.:|.:|:       |..|  |||        :|..|          ::.|   
Mouse    80 KHTLQPGEAYPCSSDKECEVGRYCHSPHQGSSACM--------LCRRK----------KKRC--- 123

  Fly   278 KGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAK 342
                  |..|.| ||    |.||                           .||.||        .
Mouse   124 ------HRDGMC-CP----GTRC---------------------------NNGICI--------P 142

  Fly   343 CAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRY-----GPNC 402
            ..|.|...:...||..|       |.|..|....|  ..:||.:  ..||.:.:.:     |..|
Mouse   143 VTESILTPHIPALDGTR-------HRDRNHGHYSN--HDLGWQN--LGRPHSKMPHIKGHEGDPC 196

  Fly   403 ELTCNCKNGAKCSPVNGTCLCAPG-WRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLC 466
            ..:.:|.:|..|:....|.:|.|. .:|..|.:..:.|:.|.:...||||..|..|:.       
Mouse   197 LRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKV------- 254

  Fly   467 TAGWKN 472
               ||:
Mouse   255 ---WKD 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 9/45 (20%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Dkk2XP_006501881.1 Dickkopf_N 91..141 CDD:282549 22/109 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.