DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and flt3

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_001921760.3 Gene:flt3 ZFINID:ZDB-GENE-050114-4 Length:956 Species:Danio rerio

Alignment Length:566 Identity:103/567 (18%)
Similarity:160/567 (28%) Gaps:207/567 (37%)


  Fly    10 LAQLVLAQADLK----------DLDGPNI-CKRREL-------YNVDVV---YTELQSFQERGST 53
            |..|||..:.||          |.||..: |...|.       ..:||.   ..|:.|..|:.|:
Zfish     9 LVLLVLHWSSLKDGLTEAHPRCDTDGSTVRCTLEETDLMSSDPIKLDVTEGQVVEIYSACEQNSS 73

  Fly    54 ---WCVTFPPRCSTYRI----------KHRVVNKTKTIAKNRIVRDCCDGYIASAGECVPHCSEP 105
               .|:.:....|:..:          |:.|:...||:...|..:         ....||.....
Zfish    74 NERKCLCYQRTNSSIHLLQCIEKLGNEKYSVICGNKTVTAVRATQ---------RRPSVPVLKAI 129

  Fly   106 CQHGRCISPEKCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGAR 170
            .:.|.....:......||..|..      .|||.:                   .:.|:|.|.:.
Zfish   130 LKAGSTNLAQLVCTSEGYPKPTL------RWYGNS-------------------DDAAEGMTSSA 169

  Fly   171 CAD----ICPEGFFGANCSEKCRCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQ-- 229
            |..    |....:...|.::||                             |.....|.:|.:  
Zfish   170 CKTESTLISYYSYLSKNPNQKC-----------------------------CASNALGEECTEVY 205

  Fly   230 --DCPCQNDGKCQP----ETGACMC---------NPG--------------------WTGDV--- 256
              |...:|..|.|.    ::|..:.         |||                    ||..:   
Zfish   206 HYDLNEKNKQKSQNIIYLKSGQSLLLRAARKHFKNPGIKWHFNNTVIKGITSLQFYDWTEHLFIE 270

  Fly   257 CANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCAN 321
            ..|....|.|  .|....|..:....|              .:.|:..|::....|.:      |
Zfish   271 SVNMAHSGLY--LCTSDTETPRNCSTH--------------VKVFEHDQIDILHLNEN------N 313

  Fly   322 DAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHT-DLCHPETGNCQCSIGWS 385
            ..:.....|.|..:..::..|........|:..:.|:.|.:.:...| .||:.|.|..|..:.  
Zfish   314 SILAKNKTGFCFQSQVFSYPKARCYWITPNQTQIQCDETSQSNFTSTFKLCNTEPGQYQMKLE-- 376

  Fly   386 SAQCTRPCTFLRYGPNC-----ELTCNCKNGAKCSPVNGTCLCAPGWRGPTCE-ESCEPGTFGQD 444
                |:..:.:|....|     ::|.. ||.:                ..||| ||..|.|....
Zfish   377 ----TQEYSVMRNVSLCISDIPKITIR-KNSS----------------FTTCETESPLPVTVSWK 420

  Fly   445 CALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAK 490
                 .|.:.|||:||        .||.|..|:| :.....|.|.|
Zfish   421 -----TCPSLAKCDPE--------DWKEIAADQP-EFTDSDQFCQK 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 15/89 (17%)
EGF_CA 274..319 CDD:304395 5/45 (11%)
DSL <479..518 CDD:302925 3/13 (23%)
DSL <567..606 CDD:302925
flt3XP_001921760.3 IGc2 225..283 CDD:197706 10/60 (17%)
PKc_like 522..907 CDD:328722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.