DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and PDGFRL

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_006198.1 Gene:PDGFRL HGNCID:8805 Length:375 Species:Homo sapiens

Alignment Length:239 Identity:40/240 (17%)
Similarity:68/240 (28%) Gaps:91/240 (38%)


  Fly   848 PPNHNFDNPVYGMQAETRLLPNN--MRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSI------N 904
            |.|.....|     .|.|:.|.|  ::.|:.....|        |..|::.:..|..:      .
Human    25 PKNKRPKEP-----GENRIKPTNKKVKPKIPKMKDR--------DSANSAPKTQSIMMQVLDKGR 76

  Fly   905 YNHDLLTKNLNADRTNPI------------VYNESLKEEHVYDEIKHKEGY-------------- 943
            :.....|.:|.|.:|..:            .|.::.|:..:  .:|..|.|              
Human    77 FQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRL--SVKQNERYGQLTLVNSTSADTG 139

  Fly   944 ---------------KDPVKIYSKILF---------PEDEYDHLDYSRPS-----------TSQK 973
                           ||..|..|..:|         |...|..:.|..|.           .|.|
Human   140 EFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAK 204

  Fly   974 PHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHE 1017
            ...||...|       :|.|:|..::...:.:.....:|..:|:
Human   205 VTLHREFPA-------KEIPANGTDIVYDMKRGFVYLQPHSEHQ 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
PDGFRLNP_006198.1 IG_like 83..145 CDD:214653 9/64 (14%)
Ig 293..372 CDD:325142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.