DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and kitb

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001137390.1 Gene:kitb ZFINID:ZDB-GENE-050916-2 Length:957 Species:Danio rerio

Alignment Length:147 Identity:30/148 (20%)
Similarity:58/148 (39%) Gaps:27/148 (18%)


  Fly   846 SW----PPNHNFDNPVYGMQAETRLLPNNMR-SKMNNFDQRSTMSTDYGD----DCNASGRVGS- 900
            ||    ||:....:.:...||:.......:. |:....:..|.::...|.    :|.||.: |. 
Zfish   436 SWYYCEPPHTRCSHLLNATQADEEFAVITVSGSEFGRSEVESRLNISKGKFHTLECVASAQ-GEQ 499

  Fly   901 ----YSINYN---HDLLTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPVKIYSKILFPED 958
                :||:..   |.|.|..|:.      |.:.|:....:...:.:|...|...:|:.|::   |
Zfish   500 AYTLFSISERTVPHKLFTPLLSG------VVSTSVLLSFILVVLLYKYMQKPKYEIHWKVI---D 555

  Fly   959 EYDHLDYSRPSTSQKPH 975
            .:|..:|:....:|.|:
Zfish   556 SFDGNNYTYIDPTQLPY 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
kitbNP_001137390.1 IG_like 121..201 CDD:214653
Ig 209..305 CDD:299845
IG 225..305 CDD:214652
Ig 309..407 CDD:299845
I-set 319..406 CDD:254352
PKc_like 547..896 CDD:304357 7/30 (23%)
Pkinase_Tyr 583..894 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.