DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and eater

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_651533.3 Gene:eater FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster

Alignment Length:1013 Identity:264/1014 (26%)
Similarity:355/1014 (35%) Gaps:342/1014 (34%)


  Fly    55 CVTFPPRCST---YRIKHRVVNKTKTI-----------------AKNRIVRDCCDGYI----ASA 95
            |:| |..||.   |::     |.|..:                 |.||.  :|..|:|    :.:
  Fly   137 CIT-PNNCSCNKGYKL-----NPTTQVCLPTCKDNCAAVNGFCAAPNRC--ECNPGFIPKPKSKS 193

  Fly    96 GECVPHCSEPCQHGRCISPEKCKCDHGY-----GG--PACDINCPPGWYGRNCSMQ--CDCL--- 148
            .||.|.|...|.:|.|.:|:||:|:..|     |.  |.|:..|..|    ||:..  |.||   
  Fly   194 FECQPKCKNGCSNGVCRAPDKCECNKFYEKDIDGNCVPICENGCVNG----NCTAPDVCQCLTGY 254

  Fly   149 ----------------NNAVCEPFSGDCECAKGYTGAR--CADICPEGFFGANCS--EKCRCENG 193
                            .|.||.. ..:|.|..|||...  |..:|.:|.....|:  |||.|.:|
  Fly   255 TKIGHNVCLAVCPEGCQNGVCVA-PNECSCNAGYTKLEGVCTPVCKDGCVNGFCASPEKCSCNDG 318

  Fly   194 --------------GKCHH----VSGECQCAPGF---TGPLCDMRCPDGKHGAQCQ--QDCPCQN 235
                          |.|.:    ..|:|.|..|:   ||..|...|..|.....|.  :.|.| |
  Fly   319 YEMDSENRCSPVCSGGCKNGFCVAPGKCSCDEGYIKGTGNSCKPICSKGCENGFCDAPEKCSC-N 382

  Fly   236 DG-------KCQP------------ETGACMCNPGW---TGDVCANKCPVGSYGPGCQ--ESCEC 276
            ||       :|.|            ..|.|.|:.|:   ||:.|...|..|.....|.  |.|.|
  Fly   383 DGYEMDGENRCSPVCSGGCKNGFCVAPGKCSCDEGYSKETGNSCKPICSKGCENGFCDAPEKCSC 447

  Fly   277 YKG-----------------------APCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCD 318
            ..|                       ||     |:|.|..||..|.          |.:|...|.
  Fly   448 NDGYEMDSENRCSPVCSGGCKNGFCVAP-----GKCSCDEGYSKET----------GNSCKPICS 497

  Fly   319 --CANDAMCDRANGTCICNPGW--TGAKCAERICEAN-KYGLDC--NRTCECDMEHTDLCHPETG 376
              |.| ..|| |...|.||.|:  .|......:|... |.|. |  ...|.||..::    .|||
  Fly   498 KGCEN-GFCD-APEKCSCNDGYEMDGENRCSPVCSGGCKNGF-CVAPEKCSCDEGYS----KETG 555

  Fly   377 N-CQ--CSIGWSSAQCTRP--CT----FLRYGPN-CELTCN--CKNGAKCSPVNGTCLCAPGWR- 428
            | |:  ||.|..:..|..|  |:    :...|.| |...|:  ||||...:|  |.|.|..|:. 
  Fly   556 NSCKPICSNGCENGFCDAPEKCSCNDGYEMDGENRCSPVCSGGCKNGFCVAP--GKCSCDEGYSK 618

  Fly   429 ------GPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQC--LCTAGWKNIKCDRP----CDL 481
                  .|.|.:.||.|..  |...:|.|.:|.:.:.| .:|  :|:.|.||..|..|    ||.
  Fly   619 ETGNSCKPICSKGCENGFC--DAPEKCSCNDGYEMDSE-NRCSPVCSGGCKNGFCIAPGKCSCDE 680

  Fly   482 NH---FGQDCAKVCD--CHNNAACNPQNGSCTCAAGW---TGERCERKCDTGKFGHDCAQ--KCQ 536
            .:   .|..|..:|.  |.|.....|:  .|:|..|:   :..||...|..|.....|..  ||.
  Fly   681 GYSKETGNSCKPICSKGCENGFCDAPE--KCSCNDGYEMDSENRCSPVCSGGCKNGFCVAPGKCS 743

  Fly   537 CDFNNSLACDATNGRC--VCKQDWGGVHCET----NCRSGYY--GEN-CDKVCR--CLNNSSCDP 590
            ||...|   ..|...|  :|.:......||.    :|..||.  ||| |..||.  |.|.....|
  Fly   744 CDEGYS---KETGNSCKPICSKGCENGFCEAPEKCSCNDGYEMDGENRCSPVCSGGCKNGFCIAP 805

  Fly   591 DSGNCICSAGW---TGAD----CAEPCPPGF------------YGMECKERCPEILHGNKSCDHI 636
              |.|.|..|:   ||..    |::.|..||            |.|:.:.||..:..|.      
  Fly   806 --GKCSCDEGYSRETGNSCKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVCSGG------ 862

  Fly   637 TGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHG-------------------GECNHVTGQ 682
                 |:.|:        |.|    ||   ||:|:.|                   |.|  |:..
  Fly   863 -----CKNGF--------CVA----PG---KCSCDEGYSKETEISCAPFCKDGCVNGLC--VSPD 905

  Fly   683 -CQCLPGWTGSNCNESCPTDTYGQG----CAQRCR---CVHHKVCRKADGMCICETGWSGTR--- 736
             |:|..|:.....::||..|....|    |.:.||   ||        :|:|.|...:...|   
  Fly   906 FCKCDDGYIFVEESKSCQLDKELLGDYSDCDKNCRNGTCV--------EGICTCSKQYKLHRNED 962

  Fly   737 -----CDEVC-PEGFYGEHCMN-TCACPSANFQCHAAHGCVCRSGYT---GDNCDEL--IASQRI 789
                 |..:| ||      |:| .|..|.:         |||..|.:   |.:|..:  :.|...
  Fly   963 DNNLICLPICEPE------CLNGLCEFPGS---------CVCWDGESPIDGYSCQSMDSLGSLTG 1012

  Fly   790 ADQSENSSRASVALTLVLMTLFACIIFAVFIYY--RRR 825
            .::||...: .|.:|:|.|.....||..:.|.|  |:|
  Fly  1013 HEKSERHLK-WVFITIVSMAFILAIITTMLIIYIFRKR 1049

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 13/57 (23%)
EGF_CA 274..319 CDD:304395 14/70 (20%)
DSL <479..518 CDD:302925 12/47 (26%)
DSL <567..606 CDD:302925 18/51 (35%)
eaterNP_651533.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.