DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and Scarf1

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001004157.2 Gene:Scarf1 MGIID:2449455 Length:820 Species:Mus musculus

Alignment Length:635 Identity:185/636 (29%)
Similarity:246/636 (39%) Gaps:183/636 (29%)


  Fly   264 GSYG----PGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAM 324
            |:.|    |..|..|   ||:.    ..:.:|.||:|.:.  .||.:..    |.....|..:.:
Mouse    20 GTQGSTLDPAGQHVC---KGSS----PSELQCCPGWRQKD--QECTIPI----CEGPDACRKEEV 71

  Fly   325 CDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQC 389
            |.:. |.|.|.||:.||:|:.| |....:|.||..||.|  .....|.|.||:|||...:     
Mouse    72 CVKP-GLCRCKPGFFGAQCSSR-CPGQYWGHDCRETCPC--HPRGQCEPATGDCQCQPNY----- 127

  Fly   390 TRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNG 454
                    :|..||..|.|....:|.|..|.|.|.|||..|||...|:             |...
Mouse   128 --------WGRLCEFPCTCGPHGQCDPKTGLCHCDPGWWSPTCRRPCQ-------------CNPA 171

  Fly   455 AKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCE 519
            ::|:..||.|:|..||             :|:.|:..|:|| .:.|...:|.|.|..||      
Mouse   172 SRCDQATGTCVCPPGW-------------WGRRCSFSCNCH-TSPCMQDSGRCVCLPGW------ 216

  Fly   520 RKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVC-RCL 583
                   :|.:|::||||....   |..|:|.|.|...:.|:.||..|..|:||..|.:.| .|.
Mouse   217 -------WGPECSRKCQCVRGQ---CSVTSGHCSCPPGFHGIRCELPCNPGHYGAQCKESCGHCE 271

  Fly   584 NNSSCDPDSGNC-ICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYI 647
            .|::|.|.:||| .|..||.|..|.:|||.|.:|..|..:||.                ||.|  
Mouse   272 LNATCSPVTGNCESCKPGWNGTQCKQPCPAGTFGERCTGQCPR----------------CRLG-- 318

  Fly   648 GLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQ-CLPGWTGSNCNESCPTDTYGQGCAQRC 711
                 .||.|                     .||.|| |.|||.|..|...||..|:|:||:..|
Mouse   319 -----EPCQA---------------------ETGHCQHCDPGWLGHRCENPCPLGTFGKGCSSTC 357

  Fly   712 RCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYT 776
            .......|....|.|:|..|:.||.|:..||.||:|.:|...|.||..  .||...| .|:.|..
Mouse   358 PACAQGTCDAVTGECVCSAGYWGTSCNSSCPAGFHGNNCSMPCQCPEG--LCHPVSG-TCQLGRH 419

  Fly   777 GDNCDELIASQRIADQSENSSRASVALTLVLMTLFACIIF----------------AVFIYYRRR 825
            |.|.  ||..            ..|.|.|:||.:..|...                |.|...:::
Mouse   420 GKNA--LIVG------------ILVPLLLLLMGIVCCAYCCSGTRLDPKDRPERNGAAFFRMKQQ 470

  Fly   826 V----------------SNLK---TEIAHVHYTHDTNPPSWPPNHNFDNP 856
            |                ||.|   ..::|    ||   |..|.||:|..|
Mouse   471 VWGALTNLGSALPCGSLSNYKLPWVTVSH----HD---PEVPFNHSFIEP 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 10/45 (22%)
DSL <479..518 CDD:302925 11/39 (28%)
DSL <567..606 CDD:302925 17/41 (41%)
Scarf1NP_001004157.2 PHA03247 <541..781 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.