DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and NimA

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster

Alignment Length:233 Identity:75/234 (32%)
Similarity:109/234 (47%) Gaps:49/234 (21%)


  Fly    20 LKDLDGP-NICKRRELYNVDVVYTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKTIAKNRI 83
            |..:.|| |||.|.|.|...|...|:|..:.|.|:||:..||||:|::.:.|.|.:.:.:.|.|.
  Fly    44 LPSIQGPGNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRVQKLNKTRT 108

  Fly    84 VRDCCDGYIA----SAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDINCPPGWYGRNCSMQ 144
            ||.||.||..    |...|.|.|...|..|.|:.|:.|.|:.||             .|::|:.:
  Fly   109 VRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGY-------------IGKHCTQR 160

  Fly   145 CDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGECQCAPGF 209
            ||                              ...:|.:|...|:|:||..|.:.||.|.|..|:
  Fly   161 CD------------------------------HDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGW 195

  Fly   210 TGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACM 247
            ||..|::.||.|.:|..|::.|.| ::..|.|:||||:
  Fly   196 TGQFCELPCPQGTYGIMCRKACDC-DEKPCNPQTGACI 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 28/65 (43%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
NimANP_001285918.1 EMI 52..116 CDD:284877 27/64 (42%)
EGF_2 170..200 CDD:285248 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D561378at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.