DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and Scarf2

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001099334.1 Gene:Scarf2 RGDID:1306013 Length:833 Species:Rattus norvegicus

Alignment Length:651 Identity:185/652 (28%)
Similarity:246/652 (38%) Gaps:211/652 (32%)


  Fly   130 INCPPGW--YGRNCSMQ-CD----CLNNAVC-EPFSGDCECAKGYTGARCADICPEGFFGANCSE 186
            :.|..||  .|..|.:. |:    |..|.|| .|  |:|.|..||.||.|...||..|:|.:|.|
  Rat    54 LTCCAGWRQLGDECGIAVCEGNSTCSENEVCVRP--GECRCRHGYFGANCDTKCPRQFWGPDCKE 116

  Fly   187 KCRCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPG 251
            :|.|...|:|..|:|:|.|..             .:.||:|:..|.||: |.|.|.:|||.|.||
  Rat   117 RCSCHPHGQCEDVTGQCTCHA-------------RRWGARCEHACQCQH-GTCHPRSGACRCEPG 167

  Fly   252 WTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMT 316
            |                                                        :|..|:..
  Rat   168 W--------------------------------------------------------WGAQCASA 176

  Fly   317 CDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCS 381
            |.|:..:.||...|.|:|:.||              :|..||..|.|   ::..|..::|.||| 
  Rat   177 CYCSATSRCDPQTGACLCHAGW--------------WGRSCNNQCSC---NSSPCEQQSGRCQC- 223

  Fly   382 IGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCA 446
                     |..||   |..|:..|.|..| :|.||:|||.|.||:||..|.|.|..|.:|..|.
  Rat   224 ---------RERTF---GARCDRYCQCFRG-RCHPVDGTCACDPGYRGKYCREPCPAGFYGLGCR 275

  Fly   447 LRC-DCQNGAKCEPETGQCL-CTAGWKNIKCDRPCDLNHFGQDCAKVC-DCHNNAACNPQNGSCT 508
            .|| .|:....|....|:|| |..||...|||:||....:|:.|...| .|.:..|||...|.||
  Rat   276 RRCGQCKGQQPCTVVEGRCLTCEPGWNGTKCDQPCATGFYGEGCGHRCPPCRDGHACNHVTGKCT 340

  Fly   509 -CAAGWTGERCERKCDTGKFGHDCAQKC-QCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGY 571
             |.|||.|:|||.||..|.:|.|||..| .|   .|..||..:|||:|.....|.||...|.:|.
  Rat   341 HCNAGWIGDRCETKCSNGTYGEDCAFVCSDC---GSGHCDFQSGRCLCSPGVHGPHCNVTCPAGL 402

  Fly   572 YGENCDKVCRCLNNSSCDPDSGNCI----------------------------CSAGWTGADCA- 607
            :|.:|.:.|.| :..||||.:|.|.                            |.....|.|.| 
  Rat   403 HGVDCAQACSC-HEESCDPVTGACHLETNQRKGVMGAGALLTLLLGLLLSLLGCCCACRGKDSAR 466

  Fly   608 -------EPCPPGFYG------MEC------KERCPEILHGNKSCDHITGEILCRTGYIGLTCE- 652
                   :..|..|.|      |:.      :::.|:::..:...|:.            |.|. 
  Rat   467 RELTLGRKKAPQRFCGSFSRISMKLPRIPLRRQKLPKVVVAHHDLDNT------------LNCSF 519

  Fly   653 -HPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHH 716
             .| |:||..|.                       |.|:......|  .||..:|...   ||.|
  Rat   520 LEP-PSGLEQPS-----------------------PSWSSRASFSS--FDTTDEGPVY---CVPH 555

  Fly   717 K 717
            :
  Rat   556 E 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 3/45 (7%)
DSL <479..518 CDD:302925 17/41 (41%)
DSL <567..606 CDD:302925 15/67 (22%)
Scarf2NP_001099334.1 PHA03247 <678..832 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.