DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and igcm-4

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_508377.1 Gene:igcm-4 WormBaseID:WBGene00022418 Length:541 Species:Caenorhabditis elegans

Alignment Length:161 Identity:34/162 (21%)
Similarity:57/162 (35%) Gaps:17/162 (10%)


  Fly   801 VALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWP-------PNHNFDNPVY 858
            :.|..|::|||..::....|:.::...:...:        |..||..|       |..|..:...
 Worm   389 LVLLAVVVTLFIFVVILAIIWLKKNQESTSGK--------DLKPPPPPRMPPPAAPQDNDWSSDR 445

  Fly   859 GMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNADRTNPIV 923
            .:.:...||.:|...|..|..:....:.|..:...|..|....|..|::..|.......|.|..:
 Worm   446 TLHSSKPLLLHNSMFKHTNPIKFHAATMDRKNMIRAERRFDEVSNVYDNSTLQPYHIQQRNNNSI 510

  Fly   924 YNESLKEEHVYDEIKH--KEGYKDPVKIYSK 952
            ||...:...||:...:  .|.|.|....|.|
 Worm   511 YNGGYRTLEVYNHRNYPTSEEYTDQDMFYYK 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
igcm-4NP_508377.1 IGc2 52..114 CDD:197706
I-set 159..235 CDD:254352
IGc2 166..225 CDD:197706
IG_like 261..373 CDD:214653
Ig 269..374 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.