DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and kin-30

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_506771.3 Gene:kin-30 / 180032 WormBaseID:WBGene00002211 Length:458 Species:Caenorhabditis elegans


Alignment Length:230 Identity:42/230 - (18%)
Similarity:79/230 - (34%) Gaps:72/230 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 RIADQSENSSRASVALTLVLMTLF----ACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWP 848
            |..:..:.|.:.::.:..::..||    ..|||....:.||                        
 Worm    14 RSVENHDESEKPNLIIVFLMCALFIYGVLSIIFVTICFLRR------------------------ 54

  Fly   849 PNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKN 913
                    :|...|...   .|.|..:.|...::.:.|:           .|.|:..:.::: :.
 Worm    55 --------IYRSSATKN---GNRRYLVQNTYVKAQLDTN-----------SSSSLPVDKEII-ET 96

  Fly   914 LNADRTNPIVYN-ESLKEEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYH 977
            ::.:...||:.: :.|.|...|      ..|....:|:|         :|||.......| .::.
 Worm    97 ISINEETPIITDYQPLNERAEY------LPYNPAFEIHS---------EHLDVFEKQFGQ-GNFG 145

  Fly   978 RMNDAMLN-INQDEEKPSNVKNMTVLLNKPLPPTE 1011
            ::|.|:|. |||   |...|..|.|.:.||...|:
 Worm   146 KVNKALLKLINQ---KTGEVVRMDVAVKKPADSTD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
kin-30NP_506771.3 TyrKc 134..428 CDD:197581 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.