DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and hir-1

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_504458.1 Gene:hir-1 WormBaseID:WBGene00016059 Length:903 Species:Caenorhabditis elegans

Alignment Length:511 Identity:84/512 (16%)
Similarity:155/512 (30%) Gaps:154/512 (30%)


  Fly   564 ETNCRSGYYGEN-CDKVCRCLNNSSCDPDSG------NCICSAGWTGADCAE--PC------PPG 613
            :..||..||.:: ..|.|..:......|.|.      .|         |..:  ||      .|.
 Worm   265 DRKCRYVYYLQSVMSKKCNTMTEMPSPPSSALQTIQVEC---------DIVKNAPCVKVPSYQPP 320

  Fly   614 FYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPA----GLYGPGCKLKCNCEH-- 672
            ..||........:....::.:.....:.....:|.:|..:..|.    |::|...:.....|.  
 Worm   321 LCGMVENVAFSVLSRDRENLNDPASNLTVNVTFIPVTRNNEMPTLYYIGIFGTASEYHTKEEETF 385

  Fly   673 -GGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTR 736
             |....||.|:.....|:..|                               |.|:.|.......
 Worm   386 LGVNITHVIGKESSCTGFDSS-------------------------------GNCLAENLNRSIV 419

  Fly   737 CDEVCPEGFYGEHCMNTCA-------------CPSANFQCHAAHGCVCRSGYTGDNCDELIASQR 788
            ...:.|:..||   :..||             ..|.:|:..|               |.::.   
 Worm   420 LQGIHPKTLYG---LTICAVKDIRNLTLPDVTLDSKSFRAKA---------------DRIML--- 463

  Fly   789 IADQSENSSRASVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWPPNHNF 853
            :|..|.|.....:.:.:..:.:....|..::.|:|::..|:|.:. .:......|     .|...
 Worm   464 VAHTSNNPVGMIIGIVIGSLVVILVAIVVIWFYFRKKSENMKFKF-QMEQVGKNN-----MNRYI 522

  Fly   854 DNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNL-NAD 917
            |.|:  |.|:..:.....|:.:.:.|::.           .||..|:.   |...|:.|:| :.|
 Worm   523 DFPI--MAAKNDIWEIERRNLIIHNDKKL-----------GSGAFGAV---YLGKLIGKSLAHKD 571

  Fly   918 RTNPIVYNESLKEEHVYDEIKHKEGYKDPVKIYSKILFPED------------------------ 958
            ..:|:..| .::.|:....:|....|.|.:   ||..|..:                        
 Worm   572 ANSPLGIN-LMRAENCQVAVKMLPEYADEM---SKHEFLREIALMKTLGYHERLVNMLACVTESE 632

  Fly   959 ------EY-DHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPL 1007
                  || |:.|..:....:..:..:::|..:|.:...|..:...||.|.|.:.|
 Worm   633 PLCLVVEYCDNGDLLKFLRERCKYMMKLDDLGINYHDPPENENYDTNMIVTLKQLL 688

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925 10/46 (22%)
hir-1NP_504458.1 fn3 85..164 CDD:278470
Pkinase_Tyr 543..841 CDD:285015 30/165 (18%)
PTKc 547..842 CDD:270623 29/161 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.