DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and Y64G10A.7

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001255802.1 Gene:Y64G10A.7 WormBaseID:WBGene00013416 Length:1714 Species:Caenorhabditis elegans

Alignment Length:887 Identity:306/888 (34%)
Similarity:402/888 (45%) Gaps:199/888 (22%)


  Fly    87 CCDGYIASA-----------GECVP--------------HCSEPCQH---GR-CISP-------- 114
            |.||:..|.           |.|.|              .|.:||.|   |: |..|        
 Worm   727 CPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENS 791

  Fly   115 -------EKCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDC--ECAKGYTGAR 170
                   .||:|..||.|..|...|.||.:|..|:|:|.|.....|:|.:|||  :|..||.|..
 Worm   792 EGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNL 856

  Fly   171 CADICPEGFFGANCSEKCRCENGGK------CHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQ 229
            |...||.|:||.:|.:||.|.:...      ||||:|.|.|.||.||||||..|....:|..|..
 Worm   857 CDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAH 921

  Fly   230 DCPCQNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPG 294
            .|.|.|..||....|:|.|.||:.|..|:..||.|.:|..|.:.|:|..||.|....|.|||.||
 Worm   922 TCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSCECAPG 986

  Fly   295 YRGERCFDECQLNTYGFNCSMTCDCA--------------------------------------- 320
            :.|::|...|...|:|.:||..||||                                       
 Worm   987 WSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGI 1051

  Fly   321 ----NDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEH-TDL-------CHP 373
                |.|.||...|:|.|.|||.|.|| :|.|...::|..||..|:|...: |.:       |..
 Worm  1052 CSCQNGATCDSVTGSCECRPGWRGKKC-DRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDH 1115

  Fly   374 ETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPV--------------------- 417
            .||.|:|..||:...|...|...|:|..|..:|.|.|||.|..|                     
 Worm  1116 VTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPE 1180

  Fly   418 ----------------------NGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPE 460
                                  ||.|.|..||.||:||..|..|.||::||.||:|:|||.|:.:
 Worm  1181 GLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRK 1245

  Fly   461 TGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTG 525
            ||:|.|..||....|::.|...|:|..|.:.|:|.|.|.|:|.:|.|:|..||.|::|.|.|..|
 Worm  1246 TGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKG 1310

  Fly   526 KFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDP 590
            .||..|:|.|:|  .||.:||..:|||.|.:.:.|..|...|..|.:||:|.:.|.|..||.||.
 Worm  1311 YFGRHCSQSCRC--ANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDA 1373

  Fly   591 DSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPC 655
            .||.|.|..|.:|:||...|..|.:|.:|.:.|.  ......||..||..:|..||||..||..|
 Worm  1374 ISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCS--CENGGVCDSSTGSCVCPPGYIGTKCEIAC 1436

  Fly   656 PAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVH-HKVC 719
            .:..:||.|:..||||:||.|:.:||||:||||:||..||:.||...:|.||.::|||.: |  |
 Worm  1437 QSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH--C 1499

  Fly   720 RKADGMCICETGWSG-------------------------TRCDEV------------------C 741
            ..:.|.|.|..|::|                         .|||.|                  |
 Worm  1500 NASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSC 1564

  Fly   742 PEGFYGEHCMNTCACPSANFQCHAAHG-CVCRSGYTGDNCDE 782
            |.||||.:|..:|:|.: ...|..|.| |:|.:|:.||.|::
 Worm  1565 PNGFYGWYCSQSCSCQN-GAHCDGADGRCLCPAGFQGDKCEQ 1605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 3/5 (60%)
EGF_CA 274..319 CDD:304395 20/45 (44%)
DSL <479..518 CDD:302925 16/39 (41%)
DSL <567..606 CDD:302925 18/39 (46%)
Y64G10A.7NP_001255802.1 EMI 35..105 CDD:284877
FXa_inhibition 159..194 CDD:291342
FXa_inhibition 200..235 CDD:291342
FXa_inhibition 241..278 CDD:291342
vWFA <319..358 CDD:294047
FXa_inhibition 366..402 CDD:291342
vWFA <460..502 CDD:294047
FXa_inhibition 509..544 CDD:291342
FXa_inhibition 550..585 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128415
Panther 1 1.100 LDO PTHR24035
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.860

Return to query results.
Submit another query.