DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and T12A7.2

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001263795.1 Gene:T12A7.2 WormBaseID:WBGene00011723 Length:369 Species:Caenorhabditis elegans

Alignment Length:340 Identity:86/341 (25%)
Similarity:107/341 (31%) Gaps:113/341 (33%)


  Fly   670 CEHGGECNHVTGQCQCLPGWTGSNCNES-CPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWS 733
            |.|||..|...|.|.|...::|..|... |..|.|          .:|.:     |.|:|.:.|.
 Worm    79 CRHGGVTNETDGSCVCTRWYSGDKCETPVCMNDGY----------FNHTL-----GRCVCTSNWV 128

  Fly   734 GTRCDEVCPEGFYGEHCMNTCAC----PSANFQCHAAH----GCVCRSGYTGD------------ 778
            |..|...|..|...: ....|.|    |....:|...|    .|.|..|:||.            
 Worm   129 GEHCIFRCNSGVVNK-TSGLCECLFGRPCTIQKCINGHFFDGKCACYEGFTGPACTICDGTVPTI 192

  Fly   779 NCDELIASQRIADQSENSSRASVALTLVLMTLFACII----FAVFIYYRRRVSNLKTEIAHVHYT 839
            .|||:|           ..|.||...|.|..|..|||    ..|..:.||...|..||.......
 Worm   193 QCDEVI-----------RKRGSVNSRLTLSGLSFCIITIGLLCVGAHRRRSAMNPVTEETWYRVF 246

  Fly   840 HDTNPPSWPPNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNAS--------- 895
            |                           |||.|.    |..|  ...||  .|..|         
 Worm   247 H---------------------------PNNNRP----FSSR--CRHDY--MCGGSWVPRDRALI 276

  Fly   896 ---GRVGSYSINYN-HDLLT--------KNLN-ADRTNPIVYNESLK---EEHVYDEIKHKEGYK 944
               |||...|.|.. |.|.|        .:|| |:...|..|.|:.:   |..:.:||:.:|. |
 Worm   277 VAPGRVSMSSTNSRVHRLATPPPSYTSVDDLNSAEAQTPPTYEEATRIEIENVIAEEIESEEA-K 340

  Fly   945 DPVKIYSKILFPEDE 959
            |.|.:..:|....||
 Worm   341 DDVGVTIEIPTSSDE 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
T12A7.2NP_001263795.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24035
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.