DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and W03A5.1

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_498153.3 Gene:W03A5.1 WormBaseID:WBGene00020966 Length:803 Species:Caenorhabditis elegans

Alignment Length:213 Identity:40/214 (19%)
Similarity:76/214 (36%) Gaps:75/214 (35%)


  Fly   858 YGMQAET------RLLPNNMR----SKMNNFDQRSTMSTDYGDDCNAS---GRVGSYSI---NYN 906
            ||:.|..      .:||.|::    :||...|..|.:.|...:....:   ..:|.|.:   .|:
 Worm   287 YGIMANAVNYFYGEMLPQNVKKERTTKMQCIDFMSEIQTTPFEPAIVTIHRSSLGHYELMGKRYD 351

  Fly   907 --HDLLTKNLNADRT---NPIVY------------------------------NESLKEEHVYDE 936
              :||: .:|:.||:   :.:||                              .|.....| :|:
 Worm   352 TLYDLV-HHLSTDRSALPHKLVYCRSSPSVVGRNFVPPPTPRFQKDLRCQPMAIEQWAATH-FDD 414

  Fly   937 IKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEK--PSNVKNM 999
            :..:....:.....:|.:|              ..:|.|:.|:.: .||::::|::  .|.:|| 
 Worm   415 VTRRFECGEKTLFATKTVF--------------DGEKKHHERLKN-RLNLSKEEKELVSSYMKN- 463

  Fly  1000 TVLLNKPLPPTEPEPQHE 1017
                ..|....|..|.||
 Worm   464 ----QGPQKKWENMPLHE 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
W03A5.1NP_498153.3 PTKc 498..761 CDD:270623
Pkinase_Tyr 500..761 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.