DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and kin-15

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_741035.2 Gene:kin-15 WormBaseID:WBGene00002199 Length:488 Species:Caenorhabditis elegans

Alignment Length:313 Identity:58/314 (18%)
Similarity:98/314 (31%) Gaps:103/314 (33%)


  Fly   775 YTGDNCDELIASQRIADQSENSSRASVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYT 839
            |:....:....:..|:.|..|.........:.::.....|:.:|.:|..:|.|....:.:.....
 Worm    23 YSNSTFESFTENPHISSQISNVLYMDQMFIIYILICILLILISVIVYLSKRYSQQMMQSSDNITN 87

  Fly   840 HDTNPPSWPPNHNFDNP----VYGMQAETRLL--PNNMRSKMNNFDQR---STMSTDYGDDCNAS 895
            ..:||.....::.:|.|    |..:..||.::  |.|.|.:...||.|   .....:..:|...|
 Worm    88 RRSNPEVRNKSNIYDLPPLLDVTSVNEETPIVKRPINERIENLEFDPRFEIDQAKLEISEDKLGS 152

  Fly   896 GRVG----------------------SYSINYNHDLLTKN---LNADRT--------NP------ 921
            |..|                      |.::..::|...:|   :..|.|        ||      
 Worm   153 GFFGEVCYGLLSMRTSNTETDTLQKLSVAVKQSNDPTQENQEKMIEDETKLMCAIGRNPNILAII 217

  Fly   922 --IVYNES--------------------------LKEEHVYDEIKHKEGYKDPVKIYSK-ILFPE 957
              :..|..                          .|:|.||:    |.||..|..|..| .:|.|
 Worm   218 GAVTANSGSARNLLIVEFVECGDLLKFLEEKKSIFKDELVYE----KNGYLLPKSIRRKTYMFNE 278

  Fly   958 DEYDHLDYSRPS--TSQK-----------------PHYHR---MNDAMLNINQ 988
            :|.|.::.|..|  ||..                 |..||   :.:.:||.|:
 Worm   279 NEDDVIEESLDSLCTSDLLSFSYQIAEGMEYLASIPCVHRDLALRNVLLNKNK 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
kin-15NP_741035.2 STYKc 147..452 CDD:214568 36/190 (19%)
PTKc 148..453 CDD:270623 36/189 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.