DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and ced-1

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_740922.1 Gene:ced-1 WormBaseID:WBGene00000415 Length:1111 Species:Caenorhabditis elegans

Alignment Length:1151 Identity:353/1152 (31%)
Similarity:496/1152 (43%) Gaps:219/1152 (19%)


  Fly     4 VILIACLA--QLV---------------LAQADLKDLDGPNICKRR------ELYNV--DVVYTE 43
            :||:..||  |:|               |.|....:..|.::|..:      ||..|  .|||.:
 Worm     3 LILLVLLATWQVVVDTRAPTFPDKLTQQLQQQGTTEPQGDHVCTVKTIVDDYELKKVIHTVVYND 67

  Fly    44 -------LQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKTIAKNRIVRDCCDGYIASAGE-CVP 100
                   |..||             |:..:...:...:.:.:.|.:.|:.|||||..:... |:|
 Worm    68 TEQCLNPLTGFQ-------------CTVEKRGQKASYQRQLVKKEKYVKQCCDGYYQTKDHFCLP 119

  Fly   101 HCSEPCQHGRCISPEKCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKG 165
            .|:.||:.|:||.|.||:||.||||..|..:|..|.:|..||..|||.|.|.|:|..|.|.|..|
 Worm   120 DCNPPCKKGKCIEPGKCECDPGYGGKYCASSCSVGTWGLGCSKSCDCENGANCDPELGTCICTSG 184

  Fly   166 YTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQD 230
            :.|.||...||:..:|.||.:.|.|:|||||:. .|:|.|:.|:.|..|..:|.:||.||:|:.:
 Worm   185 FQGERCEKPCPDNKWGPNCVKSCPCQNGGKCNK-EGKCVCSDGWGGEFCLNKCEEGKFGAECKFE 248

  Fly   231 CPCQNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGY 295
            |.|||...|....|.|:|..|:.|.:|.|:|.||.:|.||.:.|:|.....|...:|:|:| .|:
 Worm   249 CNCQNGATCDNTNGKCICKSGYHGALCENECSVGFFGSGCTQKCDCLNNQNCDSSSGECKC-IGW 312

  Fly   296 RGERCFDECQLNTYGFNCSMTCDCA------NDAMCDRANGTCICNPGWTGAKCAERICEANKYG 354
            .|:.|...|....:|..|...|.|.      ::|.||...|.|.|..|:.|.||.||.|:|.:||
 Worm   313 TGKHCDIGCSRGRFGLQCKQNCTCPGLEFSDSNASCDAKTGQCQCESGYKGPKCDERKCDAEQYG 377

  Fly   355 LDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCE--LTCNCKNGAKCSPV 417
            .||::||.|..|:|.:|.|.||.|:|..|:....|...|:...||||||  ..|:..:.::|:|.
 Worm   378 ADCSKTCTCVRENTLMCAPNTGFCRCKPGFYGDNCELACSKDSYGPNCEKQAMCDWNHASECNPE 442

  Fly   418 NGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDC-QNGAKCEPETGQCLCTAGWKNIKCDRPCDL 481
            .|:|:|.||..|..|.|.|....:|.:||.:|.| |.|..|:...|:|.|..||...:|:..|..
 Worm   443 TGSCVCKPGRTGKNCSEPCPLDFYGPNCAHQCQCNQRGVGCDGADGKCQCDRGWTGHRCEHHCPA 507

  Fly   482 NHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACD 546
            :.||.:|.|.|.|.....|:|..|.|||.||..|..|:..|..|.:|..|...|:| .|..  ||
 Worm   508 DTFGANCEKRCKCPKGIGCDPITGECTCPAGLQGANCDIGCPEGSYGPGCKLHCKC-VNGK--CD 569

  Fly   547 ATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADC----- 606
            ...|.|.|:..:.|..|.|.|..|.|||:|:..|.| :::||...:|.|:|..|..|..|     
 Worm   570 KETGECTCQPGFFGSDCSTTCSKGKYGESCELSCPC-SDASCSKQTGKCLCPLGTKGVSCDQKCD 633

  Fly   607 -------------------AEP-------CPPGFYGMECKERCPEILHGN-----------KSCD 634
                               .:|       ||||..|:.|:..||...:|:           ..||
 Worm   634 PNTFGFLCQETVTPSPCASTDPKNGVCLSCPPGSSGIHCEHNCPAGSYGDGCQQVCSCADGHGCD 698

  Fly   635 HITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKC-NCEHGGECNHVTGQCQCLPGWTGSNCNESC 698
            ..|||.:|..||.|.||...||.|.||.||.|.| .|..|..|:|:.|.|.|..|..|:.|...|
 Worm   699 PTTGECICEPGYHGKTCSEKCPDGKYGYGCALDCPKCASGSTCDHINGLCICPAGLEGALCTRPC 763

  Fly   699 PTDTYGQGCAQRCRCV-HHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACP-SANF 761
            ....:|.||.|.|||. .:|.|....|.|.|..|:.|.|||:.|.:|:||..|:..|.|. :|..
 Worm   764 SAGFWGNGCRQVCRCTSEYKQCNAQTGECSCPAGFQGDRCDKPCEDGYYGPDCIKKCKCQGTATS 828

  Fly   762 QCHAAHG-CVCRSGYTGD----------------------------NCDELIASQRIADQSE--- 794
            .|:...| |.|..|:||:                            .||..|....: ||..   
 Worm   829 SCNRVSGACHCHPGFTGEFCHALCPESTFGLKCSKECPKDGCGDGYECDAAIGCCHV-DQMSCGK 892

  Fly   795 --------NSSRASVALTLVLMTLFACI---IFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWP 848
                    |.:..|..||...:.|...:   :..:.::||.:....|             .|..|
 Worm   893 AKQEFEALNGAGRSTGLTWFFVLLIVALCGGLGLIALFYRNKYQKEK-------------DPDMP 944

  Fly   849 -------PNHN----FDNPVYGMQA---------------------------ETRLLPNNMRSKM 875
                   ||::    |.||:|..|:                           |...|.|   .|:
 Worm   945 TVSFHKAPNNDEGREFQNPLYSRQSVFPDSDAFSSENNGNHQGGPPNGLLTLEEEELEN---KKI 1006

  Fly   876 NNFDQRSTMSTDYG--DDCNASGRVGSYSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDEIK 938
            :........:.||.  |:....|...|.|.:.:.    :.||:...:    ...|.|||  ||.:
 Worm  1007 HGRSAAGRGNNDYASLDEVAGEGSSSSASASASR----RGLNSSEQS----RRPLLEEH--DEEE 1061

  Fly   939 HKEGYKD---PVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMND 981
            ..|.:::   |....:.....|:.|..:....|.|....:..|..|
 Worm  1062 FDEPHENSISPAHAVTTSNHNENPYADISSPDPVTQNSANKKRAQD 1107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 18/80 (23%)
EGF_CA 274..319 CDD:304395 13/45 (29%)
DSL <479..518 CDD:302925 16/39 (41%)
DSL <567..606 CDD:302925 15/39 (38%)
ced-1NP_740922.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143604757
eggNOG 1 0.900 E1_KOG1218
Hieranoid 1 1.000
Homologene 1 1.000 H13031
Inparanoid 1 1.050 641 1.000 Inparanoid score I437
Isobase 1 0.950 0 Normalized mean entropy S4145
OMA 1 1.010
OrthoDB 1 1.010 D34806at33208
OrthoFinder 1 1.000 FOG0001055
OrthoInspector 1 1.000 T474705
orthoMCL 1 0.900 OOG5_128415
Panther 1 1.100 LDO PTHR24035
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5768
TreeFam 1 0.960
1413.840

Return to query results.
Submit another query.