DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and flt4

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_012815191.1 Gene:flt4 XenbaseID:XB-GENE-483183 Length:1382 Species:Xenopus tropicalis

Alignment Length:128 Identity:25/129 (19%)
Similarity:52/129 (40%) Gaps:36/129 (28%)


  Fly   889 GDDCNASGRVGSYSIN----YNHDLLTKNLNADRTNPIVYNESLKEEHVY-----DEIKHKEGYK 944
            |.:.:.|....:|:..    |..:|||  |:....||:|.:  .|..|.|     .:::|:.|..
 Frog   591 GQNVSLSCHADNYTYENLQWYRLNLLT--LHDAEGNPLVLD--CKNVHQYAARMEGQLQHQSGSN 651

  Fly   945 DPVKIYSKILFP----EDEYDHLDYSRPSTSQKPHYHR----------------MNDAMLNIN 987
            ....:.:   .|    |:|.|::...:...:::.|.|:                ::|.|:|::
 Frog   652 SAALVLN---IPNISLEEEGDYVCEVQNRKTREKHCHKKYISVLAQEAPYLLQDLSDKMVNVS 711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
flt4XP_012815191.1 IG_like 244..335 CDD:214653
Ig 252..336 CDD:299845
IG_like 349..430 CDD:214653
Ig 360..433 CDD:299845
IG 583..678 CDD:214652 20/94 (21%)
IGc2 590..678 CDD:197706 20/94 (21%)
I-set 697..784 CDD:254352 3/16 (19%)
IGc2 712..774 CDD:197706 25/129 (19%)
PTKc_VEGFR3 856..1191 CDD:270680
Pkinase_Tyr 864..1184 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.