DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and tnfaip6

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_002936705.1 Gene:tnfaip6 XenbaseID:XB-GENE-988687 Length:269 Species:Xenopus tropicalis

Alignment Length:214 Identity:40/215 (19%)
Similarity:59/215 (27%) Gaps:95/215 (44%)


  Fly   503 QNGSCTCAAGWTGERCERKCDTGKFGHDCAQKC-QCDFNNSLACDATNGRCVCKQDWGGVHCETN 566
            |.|...|||||..:        |:.|:...:.. .|.|......|                    
 Frog    76 QIGFHVCAAGWLHK--------GRVGYPIVKPTFNCGFGKKGIID-------------------- 112

  Fly   567 CRSGYYGENCDKVCR----CLNNSSCDPDSGNCICSAGWTGADCAEP----CPPGF--------- 614
                 ||...:|..|    |.|     |.|..|       |....||    ..||:         
 Frog   113 -----YGFRLNKSERWDTYCYN-----PHSKEC-------GGVLTEPERIIKSPGYPNNYENDQI 160

  Fly   615 --------YG---------------MECKERCPEI------LHG--NKSCDHITGEILCRTGYIG 648
                    ||               ::|.....||      :||  .:.|.:...:.:..||.: 
 Frog   161 CYWHIRVNYGQRVFIEFLDIDIEEDIDCLSDYFEIYDSYDDIHGLVGRYCGYELPDSIISTGNV- 224

  Fly   649 LTCEHPCPAGLYGPGCKLK 667
            :|.:......:.|.|.::|
 Frog   225 MTLKFLTDRSVSGGGFQIK 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 7/15 (47%)
DSL <567..606 CDD:302925 10/43 (23%)
tnfaip6XP_002936705.1 Link_domain_TSG_6_like 36..128 CDD:239592 17/85 (20%)
CUB 135..244 CDD:278839 20/118 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.