DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and megf11

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_002938407.2 Gene:megf11 XenbaseID:XB-GENE-6045392 Length:1053 Species:Xenopus tropicalis

Alignment Length:1065 Identity:380/1066 (36%)
Similarity:519/1066 (49%) Gaps:133/1066 (12%)


  Fly    13 LVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWCVTFPP--RCSTYRIKHRVVNK- 74
            |||..|.|.:.:.||:|...|.|.|.|..:....|.:...|.|.....  :|:.:||.::...: 
 Frog    18 LVLGTAVLLNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNWFKCTRHRISYKTAYRR 82

  Fly    75 -TKTIAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDINCPPGWYG 138
             .:|:.:.|  ..||.||..|...|:|.|:|.|.||||:||:.|.|:.|:||..|...|....:|
 Frog    83 GLRTMYRRR--SQCCPGYYESGDFCIPLCTEECVHGRCVSPDTCHCEPGWGGADCSSGCDSEHWG 145

  Fly   139 RNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGEC 203
            .:||.:|.|.|.|:|.|.:|.|.|:.||.|.||.|.|..|.:|..|..:|:|:||..|.|.:|||
 Frog   146 PHCSNRCQCQNEALCNPITGACVCSDGYRGWRCEDWCDPGTYGKACQLRCQCQNGATCDHRTGEC 210

  Fly   204 QCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGP 268
            .||||:||..|:..||.|.|||.|:..|||||.|.|...||.|.|..||||.|||..||.|.:|.
 Frog   211 HCAPGYTGAFCEELCPPGSHGALCELRCPCQNGGVCHHVTGDCSCPAGWTGTVCAQPCPSGRFGV 275

  Fly   269 GCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCI 333
            .|.:.|:|:.|..|..::|:|:|..||.||||.:||.:.||||.|:..|||.|.|.|...||.|:
 Frog   276 NCSQECQCHNGGQCDPLSGRCQCAAGYTGERCQEECPVGTYGFQCAERCDCQNGAKCYHINGACL 340

  Fly   334 CNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRY 398
            |.||:.|..|.||:|....|||.||:.|.|::.:|..|||.:|.|.|..|||...|..||....|
 Frog   341 CEPGFKGILCEERVCPEGLYGLKCNKNCPCNLTNTRGCHPLSGECTCRAGWSGLYCEEPCRPGFY 405

  Fly   399 GPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQ 463
            |..|:..|:|.|||.|..:.|.|:||||:.|..|...|..||||.||...|:|||.|.|.|..|.
 Frog   406 GEGCQQLCSCHNGADCDSMTGRCICAPGYTGQDCSAPCATGTFGADCLSVCNCQNDAACSPVDGL 470

  Fly   464 CLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFG 528
            |:|..||:.:.|..||....:|.:|.:.|.|.|:|:|:|.:||||||.||.||.|::.|..|.:|
 Frog   471 CVCREGWQGLDCSIPCSSGTWGLNCNQSCLCLNDASCSPMDGSCTCAPGWMGELCDQPCLDGTYG 535

  Fly   529 HDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSG 593
            .||.:.|.|  :::..|:..:|.|.|...|.|:||:..|..||:|.||...|.|.|..||.|:.|
 Frog   536 MDCLEHCDC--SHADGCNPVSGHCHCLAGWTGIHCDNLCNQGYWGSNCSMTCHCENGGSCSPEDG 598

  Fly   594 NCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAG 658
            :|.|:.|:.||.|...|..||||.:|.:.||:.:|.:..|.|:||...|..|:.|..|...||:|
 Frog   599 SCECAPGYRGALCQRICAAGFYGHQCSQTCPQCVHFSGPCHHVTGHCDCLPGFFGPLCNQVCPSG 663

  Fly   659 LYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKAD 723
            .:|.||...|:|.:...||.|.|.|||.|||.|.:|::.||...:|..|:..|.|.:...|...|
 Frog   664 RFGKGCAEICSCSNNATCNPVDGSCQCYPGWIGIDCSDECPFGLWGPDCSHTCNCHNEAECSAYD 728

  Fly   724 GMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNC-------- 780
            |.|.|..||:|..|.:.||..|||:.|.|.|.|.:.....|....|.||:|:||::|        
 Frog   729 GECKCTPGWTGLYCTQRCPSAFYGKDCANVCQCHNGADCDHITGQCTCRTGFTGNHCEQKCPPGT 793

  Fly   781 ------------------------------------------DELIASQRI--ADQSENSSRAS- 800
                                                      :||....:|  |..||..|..: 
 Frog   794 FGYGCRQLCECLNNATCDHVTGTCYCNPGFKGIRCDQAALMMEELNPYTKISPAHGSERHSAGAI 858

  Fly   801 ---VALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWPPNHNFDNPVYGMQA 862
               :.|.|::|||     ..:|:.||:|..:...::.:|.||         |.....:..|.:..
 Frog   859 IGVIVLLLIIMTL-----LGLFLVYRQRQKDKDHDMPNVAYT---------PAMRMTSTDYALSG 909

  Fly   863 ETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNADRTNPIVYNES 927
            ..     .|..:.|.:    .|...:.|....||...|          |.:|::           
 Frog   910 AC-----GMERRQNTY----IMENGFKDCMKESGCSSS----------TCSLSS----------- 944

  Fly   928 LKEEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEK 992
              .|:.|..|      |||         |...|.|.:.|....:...|    .||..:    :..
 Frog   945 --SENPYATI------KDP---------PVQPYKHSESSYVEMTSPVH----TDAPFS----DMP 984

  Fly   993 PSNVKNMTVLLNKPLPPTEPEPQHE 1017
            ||:..|..|...:|......|.||:
 Frog   985 PSSKANTNVYDVEPTLSLLQEAQHQ 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 18/69 (26%)
EGF_CA 274..319 CDD:304395 22/45 (49%)
DSL <479..518 CDD:302925 19/39 (49%)
DSL <567..606 CDD:302925 18/39 (46%)
megf11XP_002938407.2 EMI 32..99 CDD:284877 18/69 (26%)
EGF_CA 281..326 CDD:304395 22/45 (49%)
EGF_CA 759..804 CDD:304395 10/45 (22%)
Syndecan 856..897 CDD:279386 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H13031
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D34806at33208
OrthoFinder 1 1.000 FOG0001055
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.880

Return to query results.
Submit another query.