DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and fgfr3

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_017946783.1 Gene:fgfr3 XenbaseID:XB-GENE-479255 Length:830 Species:Xenopus tropicalis

Alignment Length:234 Identity:47/235 (20%)
Similarity:73/235 (31%) Gaps:68/235 (29%)


  Fly   839 THDTNPPSWPPNHNFDN---------------PVYG--------------MQAETRLLPNNMRSK 874
            |.|..||.|......|.               |..|              .:.|.|:....:|.:
 Frog   161 TEDREPPRWTQPEKMDKKLTAVPAANTIRFRCPAAGNPTPTIHWLKNGKEFRGEHRIGGIKLRHQ 225

  Fly   875 MNNFDQRSTMSTDYGD-DCNASGRVGSYSINYNHDLLTKN---------LNADRTNPIVYNESLK 929
            ..:....|.:.:|.|: .|....:.||....|..|:|.::         |.|::|  :|....: 
 Frog   226 QWSLVMESVVPSDKGNYTCVVENKYGSIRQTYQLDVLERSSHRPILQAGLPANQT--VVIGSDV- 287

  Fly   930 EEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPS 994
            |.|              .|:||      |...|:.:.:........|....|..:.:.|.....:
 Frog   288 EFH--------------CKVYS------DAQPHIQWLKHVEVNGSKYGPDGDPYVTVLQSFTNGT 332

  Fly   995 NVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTAS 1033
            .|.  |.|..|.:..|. |.|:.|..|   |...|:.||
 Frog   333 EVD--TTLSLKNVTETH-EGQYVCRAN---NFIGVAEAS 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
fgfr3XP_017946783.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.