DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and fgfr2

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_012821350.1 Gene:fgfr2 XenbaseID:XB-GENE-1018296 Length:834 Species:Xenopus tropicalis

Alignment Length:250 Identity:42/250 (17%)
Similarity:83/250 (33%) Gaps:76/250 (30%)


  Fly   838 YTHDTN---PPSWPPNHNFDNPVYGMQAETRLL--------PNNMRSKMNNFDQRSTMSTDYGDD 891
            :|:|.|   .|.|......:..::.:.|...:.        |......:.|           |.:
 Frog   155 FTNDNNNIRAPYWTNTEKMEKKLHAVPAANTVKLRCPAGGNPTPRMRWLKN-----------GKE 208

  Fly   892 CNASGRVGSYSINYNH-DLLTKN-LNADR--TNPIVYNESLKEEHVYD-EIKHKEGYKDPV---- 947
            .....|:|.|.:...| .|:.:: :.:|:  ...||.||.....|.|. ::..:..:: |:    
 Frog   209 FKQEHRIGGYKVRNQHWSLIMESVVPSDKGIYTCIVENEHGSINHTYHLDVIERSSHR-PILQAG 272

  Fly   948 -----------------KIYSKILFPEDEYDHLDY--------SRPSTSQKPHYHRMNDAMLNIN 987
                             |:||      |...|:.:        ||......|:...:..|.:|:.
 Frog   273 LPANTTAMVGGDAEFVCKVYS------DAQPHIRWVRYIEKNGSRFGVDGLPYIKVLKAAGVNVT 331

  Fly   988 QDEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVS---TASPSS-SP 1038
            .:|.:...|:|::.         |...::.|....:..:...|   |..|:: ||
 Frog   332 DEEIEVLYVRNVSF---------EDAGEYTCIAGNSIGISQHSAWLTVHPATVSP 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
fgfr2XP_012821350.1 Ig 64..136 CDD:299845
IG_like 68..137 CDD:214653
Ig2_FGFR 175..259 CDD:143265 16/95 (17%)
IG 185..259 CDD:214652 15/85 (18%)
IG_like 274..370 CDD:214653 17/111 (15%)
Ig3_FGFR-2 282..371 CDD:143266 17/104 (16%)
PTKc_FGFR2 467..779 CDD:270679
Pkinase_Tyr 492..768 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.