DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and stab2

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_012815318.1 Gene:stab2 XenbaseID:XB-GENE-491156 Length:2560 Species:Xenopus tropicalis

Alignment Length:1527 Identity:317/1528 (21%)
Similarity:445/1528 (29%) Gaps:686/1528 (45%)


  Fly    13 LVLAQADLKDLDGPNICKR----------------RELYNVDVVYTELQSFQERGSTWCVTFPPR 61
            :||.|..||| |..|...|                .:||..|........:.::|          
 Frog  1202 IVLGQKLLKD-DLHNGMHRETLLGFSYQLGFFIHGEQLYINDAPVNNTNIYTDKG---------- 1255

  Fly    62 CSTYRIKHRVVNKTKTIAKNRIVRDCCDGYIASAGECV--PHCSEPCQHGRCISPEKCKC--DHG 122
                 :.|. |.|...|.|||...:.....::..|||:  |.|....|.   |:.||..|  ...
 Frog  1256 -----VIHG-VGKVLEIQKNRCDLNDTSLALSKCGECLTTPACPPGTQP---IASEKKSCIFTKY 1311

  Fly   123 YGGP-----ACDINCP---------PGWYGRNCSMQC------DCLNNAVCEPF---SGDCECAK 164
            |.|.     .|.:.|.         ||:||:.| :.|      .|..|.||...   :|.|:|..
 Frog  1312 YFGKRFVYIGCQVQCAKTIITRECCPGFYGQQC-LSCPGKGGNPCFGNGVCMDSINGTGTCQCKD 1375

  Fly   165 GYTGARCADICPEGFFGANCSEKCRCENGGKCH---HVSGECQCAPGFTGPLCDMRCPDGKHGAQ 226
            ||.|..| :.|.:|.:|..|.::|.|.| |||.   :..|.|.|..|:.|..||....:.|....
 Frog  1376 GYIGTAC-ETCVKGKYGPRCDQECYCIN-GKCSEGINGDGSCNCDVGWRGVKCDTAITEDKCNKS 1438

  Fly   227 CQQDCPC--QNDGKCQPETGACMCNPGWTGD--VCA--NKCPVGSYGPGCQESCECYKGAPCHHI 285
            |.....|  ..||     ...|.|..|:.||  ||:  |.|  .|...||.::.||....|.:.|
 Frog  1439 CHTSANCIVNADG-----IARCQCASGFQGDGTVCSAVNAC--ASNNGGCSDNAECRTTTPGNRI 1496

  Fly   286 TGQCECPPGYRGER--CF--DECQLNTYGFN----CSMT------CDC----ANDAM-CD----- 326
               |.|..||.|:.  |.  |.|..|..|.:    |:.|      |:|    :.|.: ||     
 Frog  1497 ---CVCKWGYTGDGIVCIEVDPCATNNGGCHKFAECTKTGANQSACNCLQRYSGDGIKCDPINPC 1558

  Fly   327 -RANGTC----ICNPGWTGAKCAERICEA-NKY---GLDC----------NR------------- 359
             :.||.|    :||  .||.  |||.||. :.|   |:||          ||             
 Frog  1559 LQKNGGCSAFAVCN--HTGP--AERTCECKSDYIGDGIDCKGTIYQELPKNRDTSTFYNQLQLNQ 1619

  Fly   360 -----------------------------TCECDMEHTDLCHPET-------------------- 375
                                         |.:..||...|.|..:                    
 Frog  1620 INDLSGPGPFTVFVPSTSAFNDESMIKEWTAKGVMEQVLLYHIVSCAQLTKDDLTSIATVTSLQG 1684

  Fly   376 ---------------GNCQC--------------------------------------------S 381
                           ||.:.                                            :
 Frog  1685 DSLTFTYSQDSVLLNGNAKIISSDTIMTNGIVHIIDKVLVPKNMQNFNKEASKIVLDSLTKVAET 1749

  Fly   382 IGWS------------------------------------------------------------- 385
            .|:|                                                             
 Frog  1750 HGYSAFSKLLQDTDILTLINDPIHQPVTIFLPTDNALKSLPKEQNDFLYDSQNKEKLLQIIKYHV 1814

  Fly   386 -------------------------SAQCT------------RPCTFLR----------YGPNCE 403
                                     |.:|.            |.|..::          ||.:|.
 Frog  1815 IRDAKIYTTDLVRKGSIKTLQGTDLSVKCADKESYGDVLLDDRQCKLVQRQLMFNGGIAYGIDCL 1879

  Fly   404 LT----------------------CN----CKNGAKCSPVNGTCLCAPGWRGPT--CEESCE--- 437
            ||                      |:    |.:|:|..|....|......|...  |...|.   
 Frog  1880 LTPSSVGGRCDNMVTFELMGSCGRCSNVPKCPSGSKPKPDKVKCTYNLSSRRTLDGCRYDCSMVV 1944

  Fly   438 ------PGTFGQDC-----ALRCDCQNGAKCE---PETGQCLCTAGWKNIKCDRPCDLNHFGQDC 488
                  .|.||:||     .....|.|...|:   ..||:|.|..|:....|:. |....:|.||
 Frog  1945 WMTKCCSGFFGRDCQGCPGGPETPCNNHGLCDDGHSGTGECRCNPGFNGTACEL-CLPGRYGPDC 2008

  Fly   489 AKVCDCHNNAAC---NPQNGSCTCAAGWTGERCERK----------CDTGKFGHDCAQK--CQCD 538
             |.|||..:..|   :..:|.|:|.:||||:|||.|          |.:...   |.:|  |||.
 Frog  2009 -KPCDCTEHGQCDGGSSGSGKCSCDSGWTGKRCETKLVLPPVCTPACSSNAV---CKEKNMCQCK 2069

  Fly   539 ---FNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAG 600
               ..:...|:..|   :|||:.||  |::|.:....|...  .|.||.....|   || :|:. 
 Frog  2070 KFYEGDGRTCNVVN---LCKQNNGG--CDSNAKCSQSGVKV--TCSCLKGYKGD---GN-VCTP- 2122

  Fly   601 WTGADCAEPCPPGFYGMECKER--CPEILHGNKSCDHITGEILCRTGYI--GLTCEHPCPAGLYG 661
                  .:||..||.| .|.|.  |.......:.|:       |:..||  ||:||..       
 Frog  2123 ------IDPCADGFNG-GCDEHAICTMTGPDKRKCE-------CKDQYIGDGLSCEVK------- 2166

  Fly   662 PGCKLKCN-C-EHGGECNHVTGQCQCL---------------PGWTGSN-------CNESCPT-D 701
               ||..| | :..|:| |....|..|               .|....|       ||:...| .
 Frog  2167 ---KLPINRCLQDNGQC-HADALCNDLHFQDSTVGVFHLRSSKGVYKYNYSEAMKACNDETATIA 2227

  Fly   702 TYGQ-GCAQRCRCVHHKVCRKADGMCICETGW-SGTR-------CDEVCPEGF-----YGEHCMN 752
            ||.| ..||:.            |..:|..|| .|.|       .::.|..||     ||     
 Frog  2228 TYNQLSYAQQA------------GFHLCAAGWLDGVRVAYPTTYSNQNCGSGFVGIVDYG----- 2275

  Fly   753 TCACPSANFQ------CHAAH--GCVCRSGYTGD--NCDELIASQRIADQSENSSRASVALTLVL 807
                |..|..      |:...  .|:|:.||.||  .|:..:                    |.:
 Frog  2276 ----PRVNLSETWDVFCYRVKDVSCICKPGYVGDGYTCNGNL--------------------LQV 2316

  Fly   808 MTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWPPNHNFDNPVYGMQAETRLL-PNNM 871
            :|.|...            ||..|||  :.|::.:     .....|.|.:..:..:..|. |:| 
 Frog  2317 LTSFPSF------------SNFLTEI--LVYSNTS-----VKGKEFFNYLTNLSVQATLFAPSN- 2361

  Fly   872 RSKMNNFDQRSTMS----------------TDYGDDCNASGRVG-SYSINYNHDLLTKNLNADRT 919
                :..::..|:|                .|..:......|:| ...|::::|..:| :..|..
 Frog  2362 ----DGLNENQTLSGRDIEYHLANVSMFFFEDLSNGTTLQTRIGHKLLISFDNDPASK-ITTDSM 2421

  Fly   920 NPIVYNESLKEEHVYDEIK------------------------HKEG------------------ 942
            .|..|.:. |....:|.|.                        |..|                  
 Frog  2422 TPTRYVDG-KPILQWDIIASNGIIHTIAEPLTAPPEPLALHAGHGAGIFFGIVLIVGLLALAVYY 2485

  Fly   943 YKDPVKIYSKILFPE-DEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKP 1006
            ||...:...:..|.: :|||          :||           |..:.::|||:.|        
 Frog  2486 YKKFNRKDFQFQFQQFNEYD----------EKP-----------IVSELDRPSNIAN-------- 2521

  Fly  1007 LPPTEPEPQHECFDNTNTNLDNVSTASPSSSP 1038
                   |.:|  .:|.|:|...|| .||..|
 Frog  2522 -------PMYE--SSTATSLPETST-EPSFHP 2543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 13/81 (16%)
EGF_CA 274..319 CDD:304395 17/59 (29%)
DSL <479..518 CDD:302925 17/42 (40%)
DSL <567..606 CDD:302925 8/39 (21%)
stab2XP_012815318.1 Plasmod_Pvs28 206..356 CDD:283826
EGF_3 324..359 CDD:289699
Fasciclin 379..501 CDD:280607
Fasciclin 524..649 CDD:280607
EGF_3 836..864 CDD:289699
EGF_3 915..950 CDD:289699
Fasciclin 1007..1128 CDD:280607
Fasciclin 1147..1264 CDD:280607 16/79 (20%)
EGF_3 1474..1510 CDD:289699 13/41 (32%)
EGF_3 1516..1552 CDD:289699 8/36 (22%)
EGF_3 1558..1594 CDD:289699 15/40 (38%)
Fasciclin 1607..1725 CDD:280607 7/118 (6%)
Fasciclin 1750..1882 CDD:280607 11/132 (8%)
Laminin_EGF 1969..2013 CDD:278482 16/46 (35%)
EGF_3 2085..2120 CDD:289699 14/43 (33%)
EGF_3 2126..2163 CDD:289699 13/45 (29%)
Link_Domain 2197..2289 CDD:295393 24/113 (21%)
FAS1 2355..2454 CDD:214719 17/106 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.