DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and scarf1

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_001344375.3 Gene:scarf1 ZFINID:ZDB-GENE-030131-8778 Length:888 Species:Danio rerio

Alignment Length:1019 Identity:231/1020 (23%)
Similarity:315/1020 (31%) Gaps:442/1020 (43%)


  Fly    84 VRD----CCDGYIASAGEC-VPHCSEPCQHGRCISPEKCKCDHGYGGPACDINCPPGWYGRNCSM 143
            |||    ||.|:..|..|| ||.|.                                  |...  
Zfish    33 VRDSSAICCSGWGQSGDECTVPLCE----------------------------------GERA-- 61

  Fly   144 QCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGECQCAPG 208
               ||.:.|| .:.|.|.|..|:.|.:|...||..|:|.:|.|.|.|...|.|...:|.|.|.| 
Zfish    62 ---CLQDEVC-VYPGLCRCKAGFYGYQCKAPCPPEFWGPDCREFCPCHPHGLCDPATGVCSCLP- 121

  Fly   209 FTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQES 273
                        .:.|:.||..|.|...|||.|..|.|.|..||....|:..|            
Zfish   122 ------------NRWGSLCQNSCKCGRHGKCDPVYGNCTCEEGWWTSTCSKAC------------ 162

  Fly   274 CECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGW 338
                                         :|.|.|              :.||:|.|.||||.|:
Zfish   163 -----------------------------QCHLAT--------------STCDQATGRCICNEGY 184

  Fly   339 TGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCE 403
            .|.||:          |.||    |   :...|...||.|||..||             :||:|:
Zfish   185 WGQKCS----------LPCN----C---YVSPCQQRTGTCQCLHGW-------------WGPSCD 219

  Fly   404 LTCNCK-NGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCD-CQNGAKCEPETGQCLC 466
            ..|.|. |.|.|....|.|||.||::.|.|.|.|:.|.:|:.|...|. |:.|..|.        
Zfish   220 RRCICNLNNADCDVQTGGCLCYPGYKEPFCNEPCDSGKYGRGCKNSCGRCEGGRPCS-------- 276

  Fly   467 TAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDC 531
                   |.|..||                  ||.|         ||.|.||:::|.        
Zfish   277 -------KLDGLCD------------------ACEP---------GWNGTRCDQRCP-------- 299

  Fly   532 AQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVC-RCLNNSSCDPDSGNC 595
                                                 :||||..|.::| .|.|...|||::|.|
Zfish   300 -------------------------------------AGYYGHRCQEICPHCRNMDPCDPETGAC 327

  Fly   596 I-CSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGL 659
            : |:.||||..|.:||..|.||..|:..|       |:|:|                        
Zfish   328 LQCNPGWTGPRCDKPCTDGRYGDGCRFLC-------KTCNH------------------------ 361

  Fly   660 YGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADG 724
                          |.|:||||:|.||||:.|.:||.:||.:.||..|:..|.| ..:.|..|.|
Zfish   362 --------------GHCDHVTGRCICLPGFQGESCNSTCPFNLYGFNCSSTCDC-GSQACHPATG 411

  Fly   725 MCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQRI 789
                                          |||                                
Zfish   412 ------------------------------ACP-------------------------------- 414

  Fly   790 ADQSENSSRASV-------ALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSW 847
                 |||||.:       ...|:|..||.|......:..:.||:           ..|.:|...
Zfish   415 -----NSSRAGLLAGLLIPLCILILALLFCCCCCGRPVEGKERVT-----------VGDGSPAVR 463

  Fly   848 PPNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRST----MSTDYGDDCNASGRVGSYSINYNHD 908
            ..:|     ||.:.|       ||.|.|......|:    ::..:.|.          .:.:||.
Zfish   464 MKHH-----VYTVLA-------NMGSAMPCITLWSSGLPRVTVSHHDP----------ELTFNHS 506

  Fly   909 LLTK--------NLNADRTNPIVYNESLKEEHVYD------EIKHK-EGYKDPVKIYSKILFPED 958
            .:.:        :...|.....||.|..:|:.:.:      |:..| ..:.||....|     ||
Zfish   507 FIEQPSSGWVIDSFETDEDGEAVYCEPPREDVLTEAGGELQELNSKCNFFPDPSTFSS-----ED 566

  Fly   959 EYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPLP--------------- 1008
            ........|.|:..|.....::.|.......:|:.|:.:::.....||.|               
Zfish   567 MSQAFGIPRTSSIAKSKRPSVSFAEGTKFSPKERRSSTQDLQGTARKPKPWGVLMISALQGGQGN 631

  Fly  1009 ---PTEPEPQHECFDNTNTNLDNVSTASP----------SSSPK 1039
               .||.|.:.:   |...|:.....||.          ||.|:
Zfish   632 QNNETETEKEEK---NDEENISEEQRASSETLQNDSERYSSGPQ 672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 6/12 (50%)
EGF_CA 274..319 CDD:304395 3/45 (7%)
DSL <479..518 CDD:302925 9/39 (23%)
DSL <567..606 CDD:302925 18/41 (44%)
scarf1XP_001344375.3 EGF_CA 361..401 CDD:304395 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.