DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: drpr and tmeff2a

Sequence 1:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001121837.1 Gene:tmeff2a ZFINID:ZDB-GENE-070912-622 Length:379 Species:Danio rerio

Alignment Length:280 Identity:64/281 (23%)
Similarity:99/281 (35%) Gaps:83/281 (30%)


  Fly   303 ECQLNTYGFNCS---------MTCD---CANDAMCDRANG--TCICNPGWTGAKCAE---RICEA 350
            :||..| |:|||         ..||   |..|..|.|...  |||||     .||..   .:|.:
Zfish    51 DCQTPT-GWNCSGDDDRDTDLFLCDTNTCKFDGECLRIGDIITCICN-----FKCNNDYVPVCGS 109

  Fly   351 N--KYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSA-------------QCTRPCTFLRYGP 400
            |  .|..:|....:...:.|::.....|:|....|..|.             :.|..|...::|.
Zfish   110 NNENYENECFLRRDACKQQTEILVVSEGSCPADAGSGSGDEAGNEGSAENGQKETSTCDICQFGA 174

  Fly   401 NCELTCN---CKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALR-CDCQNGAKCEPE- 460
            .|::...   |.....||.::...:||...|           ::...|.:: ..||...:.|.: 
Zfish   175 ECDVDAEDVWCVCNIDCSHISFNPVCASDGR-----------SYDNPCQVKEASCQRQERIEVKF 228

  Fly   461 TGQC---LCT---AG-WKNIKCDR----------------PCDLNHFGQDCAKVCDC-HNNAACN 501
            .|.|   :.|   || .:..:.|.                ||. .|:...|.. .|| :.|....
Zfish   229 LGHCQGDMITGTKAGDGQYARTDYTEEKPEVSEVARGLYIPCP-EHYKNYCVH-GDCEYPNMLST 291

  Fly   502 PQNGSCTCAAGWTGERCERK 521
            |   ||:|.:|::|.:|:.|
Zfish   292 P---SCSCHSGFSGPQCDTK 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 9/28 (32%)
DSL <479..518 CDD:302925 12/40 (30%)
DSL <567..606 CDD:302925
tmeff2aNP_001121837.1 KAZAL_FS 99..139 CDD:238052 7/40 (18%)
KAZAL 186..232 CDD:197624 10/57 (18%)
PHA02887 <266..306 CDD:165214 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.